- Catalog number70R-1653
- Product nameRabbit ApoBEC3G antibody
- Size100 ug
- PriceAsk For Price
- ApplicationsWB
- Product TypePrimary Antibodies
- Product SubtypePurified Polyclonal Antibodies
- Research AreaCell Biology
- ImmunogenApoBEC3G antibody was raised using the N terminal of APOBEC3G corresponding to a region with amino acids AKIFRGQVYSELKYHPEMRFFHWFSKWRKLHRDQEYEVTWYISWSPCTKC
- HostRabbit, Rabbits
- SpecificityApoBEC3G antibody was raised against the N terminal of APOBEC3G
- Cross ReactivityHuman
- IsotypeNA
- CloneNA
- Concentration1 mg/ml
- Form BufferLyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of APOBEC3G antibody in PBS
- StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
- Shipping InfoBlue Ice
- Gene targetApoBEC3G
- Identity:HGNC:17357
- Gene:APOBEC3G
- Long gene name:apolipoprotein B mRNA editing enzyme catalytic subunit 3G
- Synonyms gene name:apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3G
- Synonyms:CEM15MDS019dJ494G10.1FLJ12740bK150C2.7
- Discovery year:2001-12-12
- Entrez gene record:60489
- Pubmed identification:11863358
- RefSeq identity:NM_021822
- Classification:Apolipoprotein B mRNA editing enzyme catalytic subunits
- VEGA ID:OTTHUMG00000151081
- Gene symbolAPOBEC3G
- isotype filter
- NA
- Short nameRabbit ApoBEC3G antibody
- technique filter
- Antibody
- Rabbit
- TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
- Alternative techniqueantibodies, rabbit-anti