- Catalog number70R-2483
- Product nameRabbit ACADM antibody
- Size50 ug
- PriceAsk For Price
- ApplicationsWB
- Product TypePrimary Antibodies
- Product SubtypePurified Polyclonal Antibodies
- Research AreaProteases, Inhibitors, & Enzymes
- ImmunogenACADM antibody was raised using the N terminal of ACADM corresponding to a region with amino acids AAGFGRCCRVLRSISRFHWRSQHTKANRQREPGLGFSFEFTEQQKEFQAT
- HostRabbit, Rabbits
- SpecificityACADM antibody was raised against the N terminal of ACADM
- Cross ReactivityHuman
- IsotypeNA
- CloneNA
- Concentration1 mg/ml
- Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ACADM antibody in PBS
- StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
- Shipping InfoBlue Ice
- Gene targetACADM
- Identity:HGNC:89
- Gene:ACADM
- Long gene name:acyl-CoA dehydrogenase medium chain
- Synonyms gene name:acyl-Coenzyme A dehydrogenase, C-4 to C-12 straight chain
- Synonyms:MCADMCADHACAD1
- Discovery year:1986-01-01
- Entrez gene record:34
- Pubmed identification:3035565
- Classification:Acyl-CoA dehydrogenase family
- VEGA ID:OTTHUMG00000009784
- Gene symbolACADM
- isotype filter
- NA
- Short nameRabbit ACADM antibody
- technique filter
- Antibody
- Rabbit
- TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
- Alternative techniqueantibodies, rabbit-anti
Gene info
Locus Specific Databases:LRG_838