- Catalog number70R-6121
- Product namePCDHAC2 antibody
- Size50 µg
- PriceAsk For Price
- CategoryPrimary Antibody
- Antibody SubtypePolyclonal Antibodies, Purified
- Area of researchCell Biology
- Type of ImmunogenPCDHAC2 antibodies were raised using the N terminal of PCDHAC2 corresponding to a region with amino acids SPAFDQSTYRVQLREDSPPGTLVVKLNASDPDEGSNGELRYSLSSYTSDR
- Raised inRabbit
- SpecificityPCDHAC2 antibody was raised against the N terminal of PCDHAC2
- Cross ReactivityHuman,Mouse,Rat
- Method of PurificationAffinity purified
- Concentration1 mg/ml
- Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PCDHAC2 antibody in PBS
- StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
- Shipping conditionsBlue Ice
- Tested forWB
- Usage RecommendationsWB: 1 ug/ml
- Assay InformationPCDHAC2 Blocking Peptide, catalog no. 33R-8663, is also available for use as a blocking control in assays to test for specificity of this PCDHAC2 antibody
- Additional InformationThis is a rabbit polyclonal antibody against PCDHAC2, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
- URL
- More info
- Alternative to gene target
- [ "protocadherin alpha subfamily C, 2", "PCDHAC2 and IDBG-408710 and ENSG00000243232 and 56134", "calcium ion binding", "Plasma membranes", "Pcdhac2 and IDBG-139382 and ENSMUSG00000007440 and 116731,12936,12942,12943,192161,192164,353234,353236,353237", "PCDHGC3 and IDBG-646108 and ENSBTAG00000017349 and 100125301,521340,532241" ]
- Gene targetPCDHAC2
- Identity:HGNC:8677
- Gene:PCDHAC2
- Long gene name:protocadherin alpha subfamily C, 2
- Synonyms:PCDH-ALPHA-C2
- Discovery year:2000-06-28
- Entrez gene record:56134
- Pubmed identification:10380929
- RefSeq identity:NM_018899
- Classification:Clustered protocadherins
- VEGA ID:OTTHUMG00000129607
- Gene symbolPCDHAC2
- Short namePCDHAC2 antibody
- technique filter
- Antibody
- TechniqueAntibody, antibodies against human proteins, antibodies for
- Alternative techniqueantibodies