- Catalog number70R-2580
- Product namePCDH17 antibody
- Size50 µg
- PriceAsk For Price
- CategoryPrimary Antibody
- Antibody SubtypePolyclonal Antibodies, Purified
- Area of researchCell Biology
- Type of ImmunogenPCDH17 antibodies were raised using the C terminal of PCDH17 corresponding to a region with amino acids SEMGAVLEQLDHPNRDLGRESVDAEEVVREIDKLLQDCRGNDPVAVRK
- Raised inRabbit
- SpecificityPCDH17 antibody was raised against the C terminal of PCDH17
- Cross ReactivityHuman,Mouse,Rat
- Method of PurificationAffinity purified
- Concentration1 mg/ml
- Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PCDH17 antibody in PBS
- StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
- Shipping conditionsBlue Ice
- Tested forWB
- Usage RecommendationsWB: 1 ug/ml
- Assay InformationPCDH17 Blocking Peptide, catalog no. 33R-8394, is also available for use as a blocking control in assays to test for specificity of this PCDH17 antibody
- Additional InformationThis is a rabbit polyclonal antibody against PCDH17, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
- URL
- More info
- Alternative to gene target
- [ "protocadherin 17", "PCDH17 and IDBG-36343 and ENSG00000118946 and 27253", "protein binding", "Plasma membranes", "Pcdh17 and IDBG-183216 and ENSMUSG00000035566 and 219228", "PCDH17 and IDBG-628612 and ENSBTAG00000010420 and 510554" ]
- Gene targetPCDH17
- Identity:HGNC:14267
- Gene:PCDH17
- Long gene name:protocadherin 17
- Synonyms:PCDH68PCH68
- Discovery year:2000-12-19
- Entrez gene record:27253
- Pubmed identification:10835267
- RefSeq identity:NM_001040429
- Classification:Non-clustered protocadherins
- VEGA ID:OTTHUMG00000016992
- Gene symbolPCDH17
- Short namePCDH17 antibody
- technique filter
- Antibody
- TechniqueAntibody, antibodies against human proteins, antibodies for
- Alternative techniqueantibodies