- Catalog number70R-5461
- Product namePAPPA2 antibody
- Size50 µg
- PriceAsk For Price
- CategoryPrimary Antibody
- Antibody SubtypePolyclonal Antibodies, Purified
- Area of researchCardiac Markers
- Type of ImmunogenPAPPA2 antibodies were raised using the N terminal of PAPPA2 corresponding to a region with amino acids PPDLTENPAGLRGAVEEPAAPWVGDSPIGQSELLGDDDAYLGNQRSKESL
- Raised inRabbit
- SpecificityPAPPA2 antibody was raised against the N terminal of PAPPA2
- Cross ReactivityHuman
- Method of PurificationAffinity purified
- Concentration1 mg/ml
- Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PAPPA2 antibody in PBS
- StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
- Shipping conditionsBlue Ice
- Tested forWB
- Usage RecommendationsWB: 1 ug/ml
- Assay InformationPAPPA2 Blocking Peptide, catalog no. 33R-7246, is also available for use as a blocking control in assays to test for specificity of this PAPPA2 antibody
- Additional InformationThis is a rabbit polyclonal antibody against PAPPA2, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
- URL
- More info
- Gene targetPAPPA2
- Identity:HGNC:14615
- Gene:PAPPA2
- Long gene name:pappalysin 2
- Synonyms gene name:placenta-specific 3
- Synonyms:PAPPEPAPP-A2
- Discovery year:2002-04-03
- Entrez gene record:60676
- Pubmed identification:11018262, 11264294
- Classification:Sushi domain containing, Pappalysins
- VEGA ID:OTTHUMG00000035025
- Gene symbolPAPPA2
- Short namePAPPA2 antibody
- technique filter
- Antibody
- TechniqueAntibody, antibodies against human proteins, antibodies for
- Alternative techniqueantibodies