PAGE4 antibody

• Catalog number
  70R-4588
• Price
  Please ask
• Size
  50 µg

• Category
  Primary Antibody
• Antibody Subtype
  Polyclonal Antibodies, Purified
• Area of research
  Cancer
• Type of Immunogen
  PAGE4 antibodies were raised using a synthetic peptide corresponding to a region with amino acids PPIEERKVEGDCQEMDLEKTRSERGDGSDVKEKTPPNPKHAKTKEAGDGQ
• Raised in
  Rabbit
• Cross Reactivity
  Human
• Method of Purification
  Affinity purified
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PAGE4 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping conditions
  Blue Ice
• Tested for
  WB
• Usage Recommendations
  WB: 1 ug/ml
• Assay Information
  PAGE4 Blocking Peptide, catalog no. 33R-7259, is also available for use as a blocking control in assays to test for specificity of this PAGE4 antibody
• Additional Information
  This is a rabbit polyclonal antibody against PAGE4, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
• URL
• More info
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  PAGE4  
• Gene symbol
  PAGE4
• Short name
  PAGE4 antibody
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Alternative name
  Rabbit polyclonal PAGE4 antibody
• Alternative technique
  antibodies

Gene info

• Identity
  HGNC:4108
• Gene
  PAGE4
• Long gene name
  PAGE family member 4
• Synonyms gene
  • GAGEC1
• Synonyms gene name
  • G antigen, family C, 1
  • P antigen family, member 4 (prostate associated)
• Synonyms
  • PAGE-4
  • CT16.7
• GenBank acession
  • AF275258
• Locus
  Xp11.23
• Discovery year
  1999-04-15
• Entrez gene record
  9506
• Pubmed identfication
  • 9724777
• Classification
  • PAGE family
• VEGA ID
  OTTHUMG00000024155

MeSH Data

• Name
  Denaturing Gradient Gel Electrophoresis
• Concept
  Scope note: Electrophoresis in which various denaturant gradients are used to induce nucleic acids to melt at various stages resulting in separation of molecules based on small sequence differences including SNPs. The denaturants used include heat, formamide, and urea.
• Tree numbers
  • E05.196.401.402.117
  • E05.301.300.319.201
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products