- Catalog number70R-4588
- Product namePAGE4 antibody
- Size50 µg
- PriceAsk For Price
- CategoryPrimary Antibody
- Antibody SubtypePolyclonal Antibodies, Purified
- Area of researchCancer
- Type of ImmunogenPAGE4 antibodies were raised using a synthetic peptide corresponding to a region with amino acids PPIEERKVEGDCQEMDLEKTRSERGDGSDVKEKTPPNPKHAKTKEAGDGQ
- Raised inRabbit
- Cross ReactivityHuman
- Method of PurificationAffinity purified
- Concentration1 mg/ml
- Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PAGE4 antibody in PBS
- StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
- Shipping conditionsBlue Ice
- Tested forWB
- Usage RecommendationsWB: 1 ug/ml
- Assay InformationPAGE4 Blocking Peptide, catalog no. 33R-7259, is also available for use as a blocking control in assays to test for specificity of this PAGE4 antibody
- Additional InformationThis is a rabbit polyclonal antibody against PAGE4, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
- URL
- More info
- Gene targetPAGE4
- Identity:HGNC:4108
- Gene:PAGE4
- Long gene name:PAGE family member 4
- Synonyms gene name:G antigen, family C, 1, P antigen family, member 4 (prostate associated)
- Synonyms:PAGE-4, CT16.7
- Discovery year:1999-04-15
- Entrez gene record:9506
- Pubmed identification:9724777
- Classification:PAGE family
- VEGA ID:OTTHUMG00000024155
- Gene symbolPAGE4
- Short namePAGE4 antibody
- technique filter
- Antibody
- TechniqueAntibody, antibodies against human proteins, antibodies for
- Alternative techniqueantibodies