- Catalog number70R-4653
- Product namePABPC1 antibody
- Size50 µg
- PriceAsk For Price
- CategoryPrimary Antibody
- Antibody SubtypePolyclonal Antibodies, Purified
- Area of researchDNA & RNA
- Type of ImmunogenPABPC1 antibodies were raised using a synthetic peptide corresponding to a region with amino acids LRPSPRWTAQGARPHPFQNMPGAIRPAAPRPPFSTMRPASSQVPRVMSTQ
- Raised inRabbit
- Cross ReactivityHuman,Mouse,Rat
- Method of PurificationAffinity purified
- Concentration1 mg/ml
- Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PABPC1 antibody in PBS
- StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
- Shipping conditionsBlue Ice
- Tested forWB
- Usage RecommendationsWB: 1 ug/ml
- Assay InformationPABPC1 Blocking Peptide, catalog no. 33R-5379, is also available for use as a blocking control in assays to test for specificity of this PABPC1 antibody
- Additional InformationThis is a rabbit polyclonal antibody against PABPC1, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
- URL
- More info
- Gene targetPABPC1
- Identity:HGNC:8554
- Gene:PABPC1
- Long gene name:poly(A) binding protein cytoplasmic 1
- Synonyms gene name:poly(A)-binding protein, cytoplasmic 2
- Synonyms:PABP1PABPL1
- Discovery year:1992-09-28
- Entrez gene record:26986
- Pubmed identification:2885805
- RefSeq identity:NM_002568
- Classification:RNA binding motif containing, MicroRNA protein coding host genes
- VEGA ID:OTTHUMG00000164779
- Gene symbolPABPC1
- Short namePABPC1 antibody
- technique filter
- Antibody
- TechniqueAntibody, antibodies against human proteins, antibodies for
- Alternative techniqueantibodies