• Catalog number
    33R-6369
  • Product name
    Neurexophilin 4 Blocking Peptide
  • Size
    100 ug
  • Product Type
    Proteins
  • Product Subtype
    Blocking Peptides
  • Research Area
    Signal Transduction
  • Tag Conjugate
    MRLLPEWFLLLFGPWLLRKAVSAQIPESGRPQYLGLRPAAAGAGAPGQQL
  • Type1
    Synthetic
  • Form Buffer
    Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
  • Storage
    Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
  • Applications
    WB, IHC
  • Shipping Info
    Blue Ice
  • Gene target
    Neurexophilin 4
  • Gene info
    Gene info
  • Gene symbol
    NXPH4, NXPE4
  • Short name
    Neurexophilin 4 Blocking Peptide
  • technique filter
    • blocking peptide
    • Blocking
    • peptide
  • Technique
    blocking peptide, Blocking, peptide, blocking peptides, fitzgerald made this blocking amino acid sequence or peptide to block the gene target in a volume of 1. For western blot it is often requested to block your antibody and to see the band of the analyzed protein disappear. This is called a negative control by blocking the WB antibody. peptides
  • Alternative technique
    control, peptides