gentaur logogentaur logo
x

MAP4K2 Blocking Peptide

  • Catalog number
    33R-9374
  • Product name
    MAP4K2 Blocking Peptide
  • Size
    100 ug
  • Product Type
    Proteins
  • Product Subtype
    Blocking Peptides
  • Research Area
    Signal Transduction
  • Tag Conjugate
    TVTSELAAVKIVKLDPGDDISSLQQEITILRECRHPNVVAYIGSYLRNDR
  • Type1
    Synthetic
  • Form Buffer
    Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
  • Storage
    Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
  • Applications
    WB, IHC
  • Shipping Info
    Blue Ice
  • Alternative to gene target
    • [ "mitogen-activated protein kinase kinase kinase kinase 2", "BL44 and GCK and RAB8IP", "MAP4K2 and IDBG-55181 and ENSG00000168067 and 5871", "transferase activity", "Plasma membranes", "Map4k2 and IDBG-135906 and ENSMUSG00000024948 and 26412", "MAP4K2 and IDBG-643979 and ENSBTAG00000001037 and 520058" ]
  • Gene target
    MAP4K2
    • Gene info
    • Identity:HGNC:6864
    • Gene:MAP4K2
    • Long gene name:mitogen-activated protein kinase kinase kinase kinase 2
    • Synonyms:GCKBL44
    • Discovery year:1997-08-18
    • Entrez gene record:5871
    • Pubmed identification:7515885
    • RefSeq identity:NM_004579
    • Classification:Mitogen-activated protein kinase kinase kinase kinases
    • VEGA ID:OTTHUMG00000045328
  • Gene symbol
    MAP4K2
  • Short name
    MAP4K2 Blocking Peptide
  • technique filter
    • blocking peptide
    • Blocking
    • peptide
  • Technique
    blocking peptide, Blocking, peptide, blocking peptides, fitzgerald made this blocking amino acid sequence or peptide to block the gene target in a volume of 1. For western blot it is often requested to block your antibody and to see the band of the analyzed protein disappear. This is called a negative control by blocking the WB antibody. peptides
  • Alternative technique
    control, peptides