• Catalog number
    33R-3012
  • Product name
    Klotho Blocking Peptide
  • Size
    100 µg
  • Category
    Proteins
  • Antibody Subtype
    Blocking Peptides
  • Area of research
    Proteases, Inhibitors, & Enzymes
  • Residues
    FPDGFLWAVGSAAYQTEGGWQQHGKGASIWDTFTHHPLAPPGDSRNASLP
  • Type of protein
    Synthetic
  • Form Buffer
    Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
  • Storage
    Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
  • Shipping conditions
    Blue Ice
  • Tested for
    WB; IHC
  • URL
  • More info
  • Gene target
    Klotho
  • Gene info
    Gene info
    • Identity:HGNC:15527
    • Gene:KLB
    • Long gene name:klotho beta
    • Discovery year:2005-10-10
    • Entrez gene record:152831
    • RefSeq identity:NM_175737
    • Classification:Glycoside hydrolase family 1, MicroRNA protein coding host genes
    • VEGA ID:OTTHUMG00000128577
    Gene info
  • Gene symbol
    KL, KLB, LCTL
  • Short name
    Klotho Blocking Peptide
  • technique filter
    • blocking peptide
    • Blocking
    • peptide
  • Technique
    blocking peptide, Blocking, peptide, blocking peptides, fitzgerald made this blocking amino acid sequence or peptide to block the gene target in a volume of 1. For western blot it is often requested to block your antibody and to see the band of the analyzed protein disappear. This is called a negative control by blocking the WB antibody. peptides
  • Alternative technique
    control, peptides