IL4 antibody

• Catalog number
  70R-6232
• Price
  Please ask
• Size
  50 µg

• Category
  Primary Antibody
• Antibody Subtype
  Polyclonal Antibodies, Purified
• Area of research
  Cytokines & Growth Factors
• Type of Immunogen
  IL4 antibodies were raised using the middle region of IL4 corresponding to a region with amino acids LIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCS
• Raised in
  Rabbit
• Specificity
  IL4 antibody was raised against the middle region of IL4
• Cross Reactivity
  Human
• Method of Purification
  Affinity purified
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of IL4 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping conditions
  Blue Ice
• Tested for
  WB
• Usage Recommendations
  WB: 1 ug/ml
• Assay Information
  IL4 Blocking Peptide, catalog no. 33R-5062, is also available for use as a blocking control in assays to test for specificity of this IL4 antibody
• Additional Information
  This is a rabbit polyclonal antibody against IL4, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
• URL
• More info
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• Gene
  Interleukin 4 (IL4) is a cytokine that induces differentiation of naive helper T cells (Th0 cells) to Th2 cells. It is used for dendritic and T cell therapy. Upon activation by IL-4, Th2 cells subsequently produce additional IL-4 in a positive feedback loop. The cell that initially produces IL-4, thus inducing Th0 differentiation, has not been identified, but recent studies suggest that basophils may be the effector cell. It is closely related and has functions similar to Interleukin 13. Recombinant, GMP rec. E. coli interleukin-4 for cell culture supplied by GENTAUR. Free samples on request.
• French translation
  anticorps

• Gene target
  IL4  
• Gene symbol
  IL4
• Short name
  IL4 antibody
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Alternative name
  Rabbit polyclonal IL4 antibody raised against the middle region of IL4
• Alternative technique
  antibodies
• Alternative to gene target
  interleukin 4, BCGF-1 and BCGF1 and BSF-1 and BSF1 and IL-4, IL4 and IDBG-42701 and ENSG00000113520 and 3565, growth factor activity, Extracellular, Il4 and IDBG-172024 and ENSMUSG00000000869 and 16189, IL4 and IDBG-644671 and ENSBTAG00000015957 and 280824

Gene info

• Identity
  HGNC:6014
• Gene
  IL4
• Long gene name
  interleukin 4
• Synonyms
  • BSF1
  • IL-4
  • BCGF1
  • BCGF-1
  • MGC79402
• Synonyms name
  • B_cell stimulatory factor 1
  • lymphocyte stimulatory factor 1
  • B cell growth factor 1
• GenBank acession
  • M23442
• Locus
  5q31.1
• Discovery year
  1988-08-10
• Entrez gene record
  3565
• Pubmed identfication
  • 3016727
• RefSeq identity
  • NM_000589
• Classification
  • Interleukins
• VEGA ID
  OTTHUMG00000059724

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products