- Catalog number70R-3397
- Product nameFSIP1 antibody
- Size50 µg
- PriceAsk For Price
- CategoryPrimary Antibody
- Antibody SubtypePolyclonal Antibodies, Purified
- Area of researchImmunology
- Type of ImmunogenFSIP1 antibodies were raised using the middle region of FSIP1 corresponding to a region with amino acids DEKDSGLSSSEGDQSGWVVPVKGYELAVTQHQQLAEIDIKLQELSAASPT
- Raised inRabbit
- SpecificityFSIP1 antibody was raised against the middle region of FSIP1
- Cross ReactivityHuman,Mouse,Rat
- Method of PurificationAffinity purified
- Concentration1 mg/ml
- Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FSIP1 antibody in PBS
- StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
- Shipping conditionsBlue Ice
- Tested forWB
- Usage RecommendationsWB: 1 ug/ml
- Assay InformationFSIP1 Blocking Peptide, catalog no. 33R-1906, is also available for use as a blocking control in assays to test for specificity of this FSIP1 antibody
- Additional InformationThis is a rabbit polyclonal antibody against FSIP1, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
- URL
- More info
- Gene targetFSIP1
- Identity:HGNC:21674
- Gene:FSIP1
- Long gene name:fibrous sheath interacting protein 1
- Synonyms:FLJ35989
- Discovery year:2004-06-21
- Entrez gene record:161835
- Pubmed identification:14702039
- RefSeq identity:NM_152597
- VEGA ID:OTTHUMG00000172456
- Gene symbolFSIP1
- Short nameFSIP1 antibody
- technique filter
- Antibody
- TechniqueAntibody, antibodies against human proteins, antibodies for
- Alternative techniqueantibodies