- Catalog number70R-3586
- Product nameEIF4ENIF1 antibody
- Size50 µg
- PriceAsk For Price
- CategoryPrimary Antibody
- Antibody SubtypePolyclonal Antibodies, Purified
- Area of researchDNA & RNA
- Type of ImmunogenEIF4ENIF1 antibodies were raised using the N terminal of EIF4ENIF1 corresponding to a region with amino acids TEEEPEWFSAGPTSQSETIELTGFDDKILEEDHKGRKRTRRRTASVKEGI
- Raised inRabbit
- SpecificityEIF4ENIF1 antibody was raised against the N terminal of EIF4ENIF1
- Cross ReactivityHuman
- Method of PurificationAffinity purified
- Concentration1 mg/ml
- Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EIF4ENIF1 antibody in PBS
- StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
- Shipping conditionsBlue Ice
- Tested forWB
- Usage RecommendationsWB: 1 ug/ml
- Assay InformationEIF4ENIF1 Blocking Peptide, catalog no. 33R-9031, is also available for use as a blocking control in assays to test for specificity of this EIF4ENIF1 antibody
- Additional InformationThis is a rabbit polyclonal antibody against EIF4ENIF1, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
- URL
- More info
- Gene targetEIF4ENIF1
- Identity:HGNC:16687
- Gene:EIF4ENIF1
- Long gene name:eukaryotic translation initiation factor 4E nuclear import factor 1
- Synonyms:4E-TFLJ21601Clast42610509L04Rik
- Discovery year:2002-06-18
- Entrez gene record:56478
- Pubmed identification:10856257
- RefSeq identity:NM_019843
- VEGA ID:OTTHUMG00000030793
- Gene symbolEIF4ENIF1
- Short nameEIF4ENIF1 antibody
- technique filter
- Antibody
- TechniqueAntibody, antibodies against human proteins, antibodies for
- Alternative techniqueantibodies