- Catalog number70R-1107
- Product nameECHS1 antibody
- Size100 µg
- PriceAsk For Price
- CategoryPrimary Antibody
- Antibody SubtypePolyclonal Antibodies, Purified
- Area of researchProteases, Inhibitors, & Enzymes
- Type of ImmunogenECHS1 antibodies were raised using the C terminal of ECHS1 corresponding to a region with amino acids KESVNAAFEMTLTEGSKLEKKLFYSTFATDDRKEGMTAFVEKRKANFKDQ
- Raised inRabbit
- SpecificityECHS1 antibody was raised against the C terminal of ECHS1
- Cross ReactivityHuman
- Method of PurificationTotal IgG Protein A purified
- Concentration1 mg/ml
- Form BufferLyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of ECHS1 antibody in PBS
- StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
- Shipping conditionsBlue Ice
- Tested forWB
- Usage RecommendationsWB: 1.25 ug/ml
- Assay InformationECHS1 Blocking Peptide, catalog no. 33R-4359, is also available for use as a blocking control in assays to test for specificity of this ECHS1 antibody
- Additional InformationThis is a rabbit polyclonal antibody against ECHS1, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
- URL
- More info
- Gene targetECHS1
- Identity:HGNC:3151
- Gene:ECHS1
- Long gene name:enoyl-CoA hydratase, short chain 1
- Synonyms gene name:enoyl Coenzyme A hydratase, short chain, 1, mitochondrial, enoyl-CoA hydratase, short chain, 1, mitochondrial
- Synonyms:SCEH,
- Discovery year:1996-12-17
- Entrez gene record:1892
- Pubmed identification:8012501, 25393721
- Classification:MicroRNA protein coding host genes
- VEGA ID:OTTHUMG00000019320
- Gene symbolECHS1
- Short nameECHS1 antibody
- technique filter
- Antibody
- TechniqueAntibody, antibodies against human proteins, antibodies for
- Alternative techniqueantibodies