gentaur logogentaur logo
x

CFP antibody

  • Catalog number
    70R-5909
  • Product name
    CFP antibody
  • Size
    50 µg
  • Price
    Ask For Price
  • Contact us
    CFP antibody
  • Category
    Primary Antibody
  • Antibody Subtype
    Polyclonal Antibodies, Purified
  • Area of research
    Signal Transduction
  • Type of Immunogen
    CFP antibodies were raised using the middle region of CFP corresponding to a region with amino acids SMVEGQGEKNVTFWGRPLPRCEELQGQKLVVEEKRPCLHVPACKDPEEEE
  • Raised in
    Rabbit
  • Specificity
    CFP antibody was raised against the middle region of CFP
  • Cross Reactivity
    Human
  • Method of Purification
    Affinity purified
  • Concentration
    1 mg/ml
  • Form Buffer
    Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CFP antibody in PBS
  • Storage
    Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
  • Shipping conditions
    Blue Ice
  • Tested for
    WB
  • Usage Recommendations
    WB: 1 ug/ml
  • Assay Information
    CFP Blocking Peptide, catalog no. 33R-8645, is also available for use as a blocking control in assays to test for specificity of this CFP antibody
  • Additional Information
    This is a rabbit polyclonal antibody against CFP, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
  • URL
    URL
  • More info
    More_info
  • Alternative to gene target
    • [ "complement factor properdin", "BFD and PFC and PFD and PROPERDIN", "CFP and IDBG-61793 and ENSG00000126759 and 5199", "Extracellular", "Cfp and IDBG-135734 and ENSMUSG00000001128 and 18636", "CFP and IDBG-636742 and ENSBTAG00000015815 and 539605" ]
  • Gene target
    CFP
    • Gene info
    Locus Specific Databases:PFCbase: Mutation registry for properdin deficiencyGlobal Variome shared LOVDLRG_129
  • Gene symbol
    CFP
  • Short name
    CFP antibody
  • technique filter
    • Antibody
  • Technique
    Antibody, antibodies against human proteins, antibodies for
  • Alternative technique
    antibodies