gentaur logogentaur logo
x

ApoBEC3G antibody

  • Catalog number
    70R-5889
  • Product name
    ApoBEC3G antibody
  • Size
    50 µg
  • Price
    Ask For Price
  • Contact us
    ApoBEC3G antibody
  • Category
    Primary Antibody
  • Antibody Subtype
    Polyclonal Antibodies, Purified
  • Area of research
    Cell Biology
  • Type of Immunogen
    ApoBEC3G antibodies were raised using the N terminal of APOBEC3G corresponding to a region with amino acids AKIFRGQVYSELKYHPEMRFFHWFSKWRKLHRDQEYEVTWYISWSPCTKC
  • Raised in
    Rabbit
  • Specificity
    ApoBEC3G antibody was raised against the N terminal of APOBEC3G
  • Cross Reactivity
    Human
  • Method of Purification
    Affinity purified
  • Concentration
    1 mg/ml
  • Form Buffer
    Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of APOBEC3G antibody in PBS
  • Storage
    Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
  • Shipping conditions
    Blue Ice
  • Tested for
    WB; IHC
  • Usage Recommendations
    WB: 2 ug/ml; IHC: 4-8 ug/ml
  • Additional Information
    This is a rabbit polyclonal antibody against APOBEC3G. It was validated on Western Blot and immunohistochemistry. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
  • URL
    URL
  • More info
    More_info
  • Gene target
    ApoBEC3G
    • Gene info
  • Gene symbol
    APOBEC3G
  • Short name
    ApoBEC3G antibody
  • technique filter
    • Antibody
  • Technique
    Antibody, antibodies against human proteins, antibodies for
  • Alternative technique
    antibodies