alpha Actinin 4 antibody
-
Catalog number70R-1171
-
PricePlease ask
-
Size100 µg
-
-
CategoryPrimary Antibody
-
Antibody SubtypePolyclonal Antibodies, Purified
-
Area of researchCell Biology
-
Type of Immunogenalpha Actinin 4 antibodies were raised using the N terminal of ACTN4 corresponding to a region with amino acids LIHRHRPELIEYDKLRKDDPVTNLNNAFEVAEKYLDIPKMLDAEDIVNTA
-
Raised inRabbit
-
SpecificityAlpha Actinin 4 antibody was raised against the N terminal of ACTN4
-
Cross ReactivityHuman,Mouse,Rat,Dog
-
Method of PurificationTotal IgG Protein A purified
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of ACTN4 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping conditionsBlue Ice
-
Tested forWB
-
Usage RecommendationsWB: 0.625 ug/ml
-
Assay InformationAlpha Actinin 4 Blocking Peptide, catalog no. 33R-5045, is also available for use as a blocking control in assays to test for specificity of this Alpha Actinin 4 antibody
-
Additional InformationThis is a rabbit polyclonal antibody against ACTN4, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
-
DescriptionThe alpha Actinin 4 antibody is a α- or alpha protein sometimes glycoprotein present in blood.
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translationanticorps
-
Gene target
-
Gene symbolACTN4P1, ACTN4P2, ACTN4
-
Short namealpha Actinin 4 antibody
-
TechniqueAntibody, antibodies against human proteins, antibodies for
-
Alternative nameRabbit polyclonal alpha Actinin 4 antibody raised against the N terminal of ACTN4
-
Alternative techniqueantibodies
-
Gene info
-
Identity
-
Gene
-
Long gene nameactinin alpha 4 pseudogene 1
-
Locus
-
Discovery year2012-05-28
-
Entrez gene record
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene nameactinin alpha 4 pseudogene 2
-
Locus
-
Discovery year2012-05-28
-
Entrez gene record
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene nameactinin alpha 4
-
Synonyms gene
-
Synonyms gene name
- focal segmental glomerulosclerosis 1
-
GenBank acession
-
Locus
-
Discovery year1992-03-26
-
Entrez gene record
-
Pubmed identfication
-
Classification
- Actinins
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data