- Catalog number70R-2459
- Product nameALDH18A1 antibody
- Size50 µg
- PriceAsk For Price
- CategoryPrimary Antibody
- Antibody SubtypePolyclonal Antibodies, Purified
- Area of researchProteases, Inhibitors, & Enzymes
- Type of ImmunogenALDH18A1 antibodies were raised using the N terminal of ALDH18A1 corresponding to a region with amino acids SVIRHVRSWSNIPFITVPLSRTHGKSFAHRSELKHAKRIVVKLGSAVVTR
- Raised inRabbit
- SpecificityALDH18A1 antibody was raised against the N terminal of ALDH18A1
- Cross ReactivityHuman
- Method of PurificationAffinity purified
- Concentration1 mg/ml
- Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ALDH18A1 antibody in PBS
- StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
- Shipping conditionsBlue Ice
- Tested forWB
- Usage RecommendationsWB: 1 ug/ml
- Assay InformationALDH18A1 Blocking Peptide, catalog no. 33R-8914, is also available for use as a blocking control in assays to test for specificity of this ALDH18A1 antibody
- Additional InformationThis is a rabbit polyclonal antibody against ALDH18A1, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
- URL
- More info
- Gene targetALDH18A1
- Identity:HGNC:9722
- Gene:ALDH18A1
- Long gene name:aldehyde dehydrogenase 18 family member A1
- Synonyms gene name:pyrroline-5-carboxylate synthetase (glutamate gamma-semialdehyde synthetase), spastic paraplegia 9 (autosomal dominant)
- Synonyms:P5CS,
- Discovery year:1996-10-02
- Entrez gene record:5832
- Pubmed identification:8921385, 26297558
- RefSeq identity:NM_002860
- Classification:Aldehyde dehydrogenases
- VEGA ID:OTTHUMG00000018815
- Gene symbolALDH18A1
- Short nameALDH18A1 antibody
- technique filter
- Antibody
- TechniqueAntibody, antibodies against human proteins, antibodies for
- Alternative techniqueantibodies