- Catalog number70R-3468
- Product nameACBD7 antibody
- Size50 µg
- PriceAsk For Price
- CategoryPrimary Antibody
- Antibody SubtypePolyclonal Antibodies, Purified
- Area of researchProteases, Inhibitors, & Enzymes
- Type of ImmunogenACBD7 antibodies were raised using the N terminal of ACBD7 corresponding to a region with amino acids MALQADFDRAAEDVRKLKARPDDGELKELYGLYKQAIVGDINIACPGMLD
- Raised inRabbit
- SpecificityACBD7 antibody was raised against the N terminal of ACBD7
- Cross ReactivityHuman
- Method of PurificationAffinity purified
- Concentration1 mg/ml
- Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ACBD7 antibody in PBS
- StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
- Shipping conditionsBlue Ice
- Tested forWB
- Usage RecommendationsWB: 1 ug/ml
- Assay InformationACBD7 Blocking Peptide, catalog no. 33R-5696, is also available for use as a blocking control in assays to test for specificity of this ACBD7 antibody
- Additional InformationThis is a rabbit polyclonal antibody against ACBD7, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
- URL
- More info
- Gene targetACBD7
- Identity:HGNC:17715
- Gene:ACBD7
- Long gene name:acyl-CoA binding domain containing 7
- Synonyms gene name:acyl-Coenzyme A binding domain containing 7
- Synonyms:FLJ38219bA455B2.2
- Discovery year:2004-05-27
- Entrez gene record:414149
- Pubmed identification:28690493
- VEGA ID:OTTHUMG00000017725
- Gene symbolACBD7
- Short nameACBD7 antibody
- technique filter
- Antibody
- TechniqueAntibody, antibodies against human proteins, antibodies for
- Alternative techniqueantibodies