gentaur logogentaur logo
x

ABCD2 Blocking Peptide

  • Catalog number
    33R-2927
  • Product name
    ABCD2 Blocking Peptide
  • Size
    100 µg
  • Category
    Proteins
  • Antibody Subtype
    Blocking Peptides
  • Area of research
    Cell Biology
  • Residues
    FIIKLIKWLMIAIPATFVNSAIRYLECKLALAFRTRLVDHAYETYFTNQT
  • Type of protein
    Synthetic
  • Form Buffer
    Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
  • Storage
    Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
  • Shipping conditions
    Blue Ice
  • Tested for
    WB; IHC
  • URL
    URL
  • More info
    More_info
  • Alternative to gene target
    • [ "ATP-binding cassette, sub-family D (ALD), member 2", "ABC39 and ALDL1 and ALDR and ALDRP and hALDR", "ABCD2 and IDBG-26995 and ENSG00000173208 and 225", "ATPase activity", "Plasma membranes", "Abcd2 and IDBG-175455 and ENSMUSG00000055782 and 26874", "BT.87418 and IDBG-633512 and ENSBTAG00000038043 and 100335783,101909154,526436" ]
  • Gene target
    ABCD2
    • Gene info
  • Gene symbol
    ABCD2
  • Short name
    ABCD2 Blocking Peptide
  • technique filter
    • blocking peptide
    • Blocking
    • peptide
  • Technique
    blocking peptide, Blocking, peptide, blocking peptides, fitzgerald made this blocking amino acid sequence or peptide to block the gene target in a volume of 1. For western blot it is often requested to block your antibody and to see the band of the analyzed protein disappear. This is called a negative control by blocking the WB antibody. peptides
  • Alternative technique
    control, peptides