- Catalog number70R-5403
- Product nameA1BG antibody
- Size50 µg
- PriceAsk For Price
- CategoryPrimary Antibody
- Antibody SubtypePolyclonal Antibodies, Purified
- Area of researchSignal Transduction
- Type of ImmunogenA1BG antibodies were raised using the N terminal of A1BG corresponding to a region with amino acids MAPVSWITPGLKTTAVCRGVLRGVTFLLRREGDHEFLEVPEAQEDVEATF
- Raised inRabbit
- SpecificityA1BG antibody was raised against the N terminal of A1BG
- Cross ReactivityHuman
- Method of PurificationAffinity purified
- Concentration1 mg/ml
- Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of A1BG antibody in PBS
- StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
- Shipping conditionsBlue Ice
- Tested forWB
- Usage RecommendationsWB: 0.1 ug/ml
- Additional InformationThis is a rabbit polyclonal antibody against A1BG, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
- URL
- More info
- Gene targetA1BG
- Identity:HGNC:37133
- Gene:A1BG-AS1
- Long gene name:A1BG antisense RNA 1
- Synonyms gene name:non-protein coding RNA 181, A1BG antisense RNA (non-protein coding), A1BG antisense RNA 1 (non-protein coding)
- Synonyms:FLJ23569,
- Discovery year:2009-07-20
- Entrez gene record:503538
- RefSeq identity:NR_015380
- Classification:Antisense RNAs
- VEGA ID:OTTHUMG00000183508
- Gene symbolA1BG, A1BG-AS1
- Short nameA1BG antibody
- technique filter
- Antibody
- TechniqueAntibody, antibodies against human proteins, antibodies for
- Alternative techniqueantibodies