• Catalog number
    33R-1734
  • Product name
    2-PDE Blocking Peptide
  • Size
    100 µg
  • Category
    Proteins
  • Antibody Subtype
    Blocking Peptides
  • Area of research
    Signal Transduction
  • Residues
    CLDYIFIDLNALEVEQVIPLPSHEEVTTHQALPSVSHPSDHIALVCDLKW
  • Type of protein
    Synthetic
  • Form Buffer
    Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
  • Storage
    Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
  • Shipping conditions
    Blue Ice
  • Tested for
    WB; IHC
  • URL
  • More info
  • Gene target
    2-PDE
  • Gene info
    Gene info
    Gene info
    Gene info
    Gene info
    Gene info
    Gene info
    Gene info
    Gene info
    Gene info
  • Gene symbol
    PDE12, PDE3A, ALDH7A1, MIR1289-2, MIR521-2, MIR509-2, MIR512-2, MIR7-2, MIR329-2, RNU6-2
  • Short name
    2-PDE Blocking Peptide
  • technique filter
    • blocking peptide
    • Blocking
    • peptide
  • Technique
    blocking peptide, Blocking, peptide, blocking peptides, fitzgerald made this blocking amino acid sequence or peptide to block the gene target in a volume of 1. For western blot it is often requested to block your antibody and to see the band of the analyzed protein disappear. This is called a negative control by blocking the WB antibody. peptides
  • Alternative technique
    control, peptides