• Catalog number
    PB9626
  • Product name
    Gremlin 1 Antibody
  • Size
    0,1 mg
  • Target antigen
    Gremlin 1
  • Clonality
    Polyclonal antibody
  • Clone
    Polyclonal antibody
  • Raised in
    rabbit
  • Type of the antibody
    IgG polyclonal antibody
  • Product form
    freeze-dried
  • Reacts with species
    human, mouse, rat
  • Analyses
    WB
  • Immunogen
    A synthetic peptide corresponding to a sequence at the C-terminus of human Gremlin 1 (151-184aa TMMVTLNCPELQPPTKKKRVTRVKQCRCISIDLD), identical to the related mouse and rat sequences.
  • Product configuration
    Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
  • Purification
    Immunogen affinity purified.
  • Solubilization
    The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
  • Storage condtions
    Keep the Gremlin 1 Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
  • Tips
    The Gremlin 1 Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
  • Background
    Gremlin, also known as Drm, is a highly conserved 20.7-kDa, 184 amino acid glycoprotein part of the DAN family and is a cysteine knot-secreted protein. Skeletal cells synthesize bone morphogenetic proteins (BMPs) and BMP antagonists. And Gremlin is expressed in osteoblasts and opposes BMP effects on osteoblastic differentiation and function in vitro. Gremlin 1 (GREM 1) is known for its antagonistic reaction with BMPs in the TGF beta signaling pathway. This gene inhibits BMP-2, BMP-4, and BMP-7. Inhibition by grem 1 of BMPs in mice allow the expression of fibroblast growth factors (FGFs) 4 and 8 and Sonic hedgehog (SHH) which are necessary for proper limb development. Gremlin 1 may play an oncogenic role especially in carcinomas of the uterine cervix, lung, ovary, kidney, breast, colon, pancreas, and sarcoma. Over-expressed gremlin 1 functions by interaction with YWHAH (Its binding site for gremlin 1 was located between residues 61-80 and gremlin 1 binding site for YWHAH was found to be located between residues 1-67). Therefore, Gremlin 1 and its binding protein YWHAH could be good targets for developing diagnostic and therapeutic strategies against human cancers.
  • Related articles
    1. Gazzero E, Pereira RC, Jorgetti V, Olson S, Economides AN, Canalis E (2005). "Skeletal overexpression of gremlin impairs bone formation and causes osteopenia". Endocrinology 142(2):655-665. 2. Namkoong H, Shin SM, Kim HK, Ha S, Cho GW, Hur SY, Kim TE, Kim JW (2006). "The bone morphognentic protein antagonist gremlin 1 is overespressed in human cancers and interacts with YWAHAH protein". BMC cancer 6:74. 3. Stabile H, Mitola S, Moroni E, Belleri M, Nicoli S, Coltrini D, Peri F, Pessi A, Orsatti L, Talamo F (2007). Blood 109(5):1834-1840.
  • Gene Name
    GREM1
  • Protein Name
    Gremlin-1
  • Gene Full Name
    gremlin 1
  • Synonyms
    BMP antagonist 1 antibody|Cell proliferation inducing gene 2 protein antibody|Cell proliferation-inducing gene 2 protein antibody| CKTSF1B1 antibody|Cysteine knot superfamily 1 antibody|Cysteine knot superfamily 1, BMP antagonist 1 antibody|Cysteine knot superfamily BMP antagonist 1 antibody|DAN domain family member 2 antibody|DAND2 antibody|Down regulated in Mos-transformed cells protein antibody|Down-regulated in Mos-transformed cells protein antibody|DRM antibody|grem1 antibody|GREM1_HUMAN antibody|Gremlin 1 like protein antibody| Gremlin 1, cysteine knot superfamily, homolog antibody|GREMLIN antibody|Gremlin-1 antibody| Gremlin1 antibody| IHG-2 antibody|IHG2 antibody|Increased in high glucose 2 antibody| Increased in high glucose protein 2 antibody|PIG2 antibody| Proliferation inducing gene 2 antibody|proliferation inducing gene 2 protein antibody
  • Uniprot ID
    O60565
  • Entrez GeneID
    26585
  • Gene target
    Gremlin 1
  • Gene info
  • Gene symbol
    GREM1
  • Short name
    Gremlin 1 Antibody
  • technique filter
    • Antibody
  • Technique
    Antibody, antibodies against human proteins, antibodies for
  • Alternative technique
    antibodies