- Catalog numberA00023
- Product nameAnti-EGFR Picoband Antibody
- Size100ug/vial
- PriceAsk For Price
- ClonalityPolyclonal
- Sample Size Available30ug for $99, contact us for details
- HostRabbit
- ImmunogenA synthetic peptide corresponding to a sequence at the N-terminus of human EGFR (25-57aa LEEKKVCQGTSNKLTQLGTFEDHFLSLQRMFNN), different from the related mouse sequence by two amino acids.
- FormLyophilized
- PurificationImmunogen affinity purified.
- Storage Transport ConditionsAt -20°C for one year. After reconstitution, at 4?C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
- Cross reactivityNo cross reactivity with other proteins.
- Ig TypeN/A
- IsotypeNA
- ReconstitutionAdd 0.2ml of distilled water will yield a concentration of 500ug/ml.
- Application DetailsWestern blot, 0.1-0.5µg/ml, Human, Mouse, Rat
- ApplicationsWB
- ReactivityHuman, Mouse, Rat
- Product Datasheetwww.bosterbio.com/datasheet.php?sku=A00023
- Alternative to gene target
- [ "epidermal growth factor receptor", "ERBB and ERBB1 and HER1 and mENA and PIG61", "EGFR and IDBG-16933 and ENSG00000146648 and 1956", "transferase activity", "nuclei", "Egfr and IDBG-151194 and ENSMUSG00000020122 and 13649", "EGFR and IDBG-644035 and ENSBTAG00000011628 and 407217" ]
- Gene targetEGFR Picoband
- Identity:HGNC:40207
- Gene:EGFR-AS1
- Long gene name:EGFR antisense RNA 1
- Discovery year:2012-11-06
- Entrez gene record:100507500
- Pubmed identification:26271667, 28920960
- RefSeq identity:NR_047551
- Classification:Antisense RNAs
- VEGA ID:OTTHUMG00000156126
- Identity:HGNC:54482
- Gene:EGILA
- Long gene name:EGFR interacting lncRNA
- Synonyms:Lnc-EGFR
- Discovery year:2019-09-27
- Pubmed identification:28541302
- Classification:Long non-coding RNAs with non-systematic symbols
- Identity:HGNC:3236
- Gene:EGFR
- Long gene name:epidermal growth factor receptor
- Synonyms gene name:epidermal growth factor receptor (avian erythroblastic leukemia viral (v-erb-b) oncogene homolog)
- Synonyms:ERBB1ERRP
- Discovery year:1986-01-01
- Entrez gene record:1956
- Pubmed identification:1505215
- RefSeq identity:NM_005228
- Classification:Erb-b2 receptor tyrosine kinases
- VEGA ID:OTTHUMG00000023661
- Identity:HGNC:20561
- Gene:RHBDF1
- Long gene name:rhomboid 5 homolog 1
- Synonyms gene name:chromosome 16 open reading frame 8, rhomboid family 1 (Drosophila), rhomboid 5 homolog 1 (Drosophila)
- Synonyms:EGFR-RS, FLJ2235, Dist1iRhom1
- Discovery year:2003-04-07
- Entrez gene record:64285
- Pubmed identification:8318735, 15965977
- RefSeq identity:NM_022450
- Classification:Rhomboid family
- VEGA ID:OTTHUMG00000060719
- Gene symbolEGFR-AS1, EGILA, EGFR, RHBDF1
- isotype filter
- NA
- Short nameAnti-EGFR Picoband Antibody
- technique filter
- Antibody
- anti-
- anti
- TechniqueAntibody, anti-, anti, antibody to, antibodies, antibodies against human proteins, antibodies for
- Alternative techniqueantibodies
Gene info
Gene info
Gene info
Locus Specific Databases:LRG_304