gentaur logogentaur logo
x

MMP 13 (Procollagenase 3), His-tagged (Recombinant Protein)

  • Catalog number
    30 100 802
  • Product name
    MMP 13 (Procollagenase 3), His-tagged (Recombinant Protein)
  • Size
    10 µg/ 50µl
  • Protein type
    Recombinant
  • Protein subtype
    EC 3.4.24.35
  • Protein family
    Matrix Metalloproteinases, matrixins
  • Protein description
    MMP13 plays a role in the degradation of extracellular matrix proteins including fibrillar collagen, fibronectin, TNC and ACAN. Cleaves triple helical collagens, including type I, type II and type III collagen, but has the highest activity with soluble type II collagen. Can also degrade collagen type IV, type XIV and type X. May also function by activating or degrading key regulatory proteins, such as TGFB1 and CTGF. Plays a role in wound healing, tissue remodeling, cartilage degradation, bone development, bone mineralization and ossification. Required for normal embryonic bone development and ossification. Plays a role in the healing of bone fractures via endochondral ossification. Plays a role in wound healing, probably by a mechanism that involves proteolytic activation of TGFB1 and degradation of CTGF. Plays a role in keratinocyte migration during wound healing. May play a role in cell migration and in tumor cell invasion
  • Research area interests
    Diseases associated with MMP13 include Spondyloepimetaphyseal Dysplasia, Missouri Type and Metaphyseal Dysplasia, Spahr Type. Among its related pathways are Integrin Pathway and Development_Glucocorticoid receptor signaling.
  • Package form
    liquid
  • Tested applications
    Degradation of extracellular Matrix; Screening and evaluation of MMP inhibitors; Antigen standard
  • Other names
    Matrix Metalloproteinase 13 (Procollagenase 3)
  • Peptide sequence
    MHPGVLAAFLFLSWTHCRALPLPSGGDEDDLSEEDLQFAERYLRSYYHPTNLAGILKENAASSMTERLREMQSFFGLEVTGKLDDNTLDVMKKPRCGVPDVGEYNVFPRTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFTRLHDGIADIMISFGIKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTYTGKSHFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGET MIFKDRFFWRLHPQQVDAELFLTKSFWPELPNRIDAAYEHPSHDLIFIFRGRKFWALNGYDILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLIEEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPANSILWCHHHHHH
  • Available target modification
    No
  • Expression system
    Insect Cell
  • Product Subtype
    full length
  • Active form
    Yes, after APMA activation
  • Tag
    His-tagged
  • Contents
    50 mM Tris-HCl, pH 7.5, 150 mM NaCl, 5 mM CaCl2, 0.05 % Brij-35
  • Protein purity
    >95%
  • Molecular weight
    60 kDa
  • UniProt number
    P45452
  • Gene number
    4322
  • Abbreviation
    MMP13
  • Full name
    matrix metallopeptidase 13
  • Other desciption
    Human recombinant procollagenase-3 is expressed in Sf9-insect cells using the baculovirus expression vector system and purified from cell culture supernatant.
  • Purification
    Mentioned in the data sheet
  • PubMed citations
    See the data sheet
  • Warnings
    For Research Use only.
  • Shipping conditions
    dry ice
  • Storage condition
    Store at -70°C
  • Technical datasheet
    Contact us to receive the datasheet
  • Representative figure
    Representative_figure
  • Other products
    Other_products
  • Gene target
    MMP 13 Procollagenase 3 His-tagged Protein
    • Gene info
    Gene info
    Gene info
    Gene info
    Gene info
    Gene info
    Gene info
  • Gene symbol
    MMP24, MMP14, MMP28, MMP17, MMP15, MMP25, MMP16
  • Short name
    MMP 13 (Procollagenase 3), His-tagged (Recombinant Protein)
  • Label
    his-tagged
  • label filter
    • his-tagged
  • technique filter
    • Recombinant
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. biotez advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Alternative technique
    rec