- Catalog number70R-6669
- Product nameRabbit SLC41A3 antibody
- Size50 ug
- PriceAsk For Price
- ApplicationsWB
- Product TypePrimary Antibodies
- Product SubtypePurified Polyclonal Antibodies
- Research AreaCell Biology
- ImmunogenSLC41A3 antibody was raised using the C terminal of SLC41A3 corresponding to a region with amino acids WHQALDPDNHCIPYLTGLGDLLGSSSVGHTAAVPRRCTASPGWGLIQPFI
- HostRabbit, Rabbits
- SpecificitySLC41A3 antibody was raised against the C terminal of SLC41A3
- Cross ReactivityHuman
- IsotypeNA
- CloneNA
- Concentration1 mg/ml
- Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC41A3 antibody in PBS
- StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
- Shipping InfoBlue Ice
- Gene targetSLC41A3
- Identity:HGNC:55559
- Gene:SLC41A3-AS1
- Long gene name:SLC41A3 antisense RNA 1
- Discovery year:2021-04-08
- Entrez gene record:112267887
- Classification:Antisense RNAs
- Identity:HGNC:31046
- Gene:SLC41A3
- Long gene name:solute carrier family 41 member 3
- Synonyms gene name:solute carrier family 41, member 3
- Synonyms:FLJ20473
- Discovery year:2004-01-26
- Entrez gene record:54946
- RefSeq identity:NM_017836
- Classification:Solute carriers
- VEGA ID:OTTHUMG00000162678
- Gene symbolSLC41A3-AS1, SLC41A3
- isotype filter
- NA
- Short nameRabbit SLC41A3 antibody
- technique filter
- Antibody
- Rabbit
- TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
- Alternative techniqueantibodies, rabbit-anti