• Catalog number
    RPC20212
  • Product name
    Recombinant Rat Cellular tumor antigen p53(Tp53)
  • Size
    100 μg
  • Verified reactivity
    Rattus norvegicus (Rat)
  • Protein number
    P10361
  • Gene number
    Tp53
  • Other name
    Tumor suppressor p53
  • Protein origin
    E.coli
  • Protein region
    1-391aa
  • Protein sequence
    MEDSQSDMSIELPLSQETFSCLWKLLPPDDILPTTATGSPNSMEDLFLPQDVAELLEGPEEALQVSAPAAQEPGTEAPAPVAPASATPWPLSSSVPSQKTYQGNYGFHLGFLQSGTAKSVMCTYSISLNKLFCQLAKTCPVQLWVTSTPPPGTRVRAMAIYKKSQHMTEVVRRCPHHERCSDGDGLAPPQHLIRVEGNPYAEYLDDRQTFRHSVVVPYEPPEVGSDYTTIHYKYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENFRKKEEHCPELPPGSAKRALPTSTSSSPQQKKKPLDGEYFTLKIRGRERFEMFRELNEALELKDARAAEESGDSRAHSSYPKTKKGQSTSRHKKPMIKKVGPDSD
  • Information about sequence
    Full Length
  • Label
    N-terminal 6xHis-tagged
  • Expected molecular weight
    47.5kDa
  • Protein purity
    ≥ 90%
  • Storage recommendation
    Aliquot and store at -20°C. Minimize freezing and thawing.
  • Use before
    1 year
  • Shipping requirements
    Blue ice
  • Estimated production time
    7-11 business days
  • Notes
    For research use only. Not for diagnostic procedures.
  • Hyperlink
  • Alternative to gene target
    • [ "tumor protein p53", "BCC7 and LFS1 and P53 and TRP53", "TP53 and IDBG-26364 and ENSG00000141510 and 7157", "MDM2/MDM4 family protein binding", "nuclei", "Trp53 and IDBG-191036 and ENSMUSG00000059552 and 22059", "TP53 and IDBG-635147 and ENSBTAG00000001069 and 281542" ]
  • Gene target
    Cellular tumor p53 Tp53
  • Host
    Rat
  • Short name
    Recombinant Cellular tumor antigen p53(Tp53)
  • label filter
    • N terminal 6xHis tagged
  • technique filter
    • Recombinant
    • cellular
    • antigen
  • Technique
    Recombinant, cellular, antigen, antigenes, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Alternative technique
    rec, antigenes
  • Tissue
    cellular, tumor
  • tissue filter
    • cellular
    • tumor