Recombinant Mycobacterium tuberculosis Diacylglycerol acyltransferase/mycolyltransferase Ag85C(fbpC)

• Catalog number
  RPC20321
• Price
  Please ask
• Size
  1 mg

• Verified reactivity
  Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
• Protein number
  P9WQN8
• Gene number
  fbpC
• Other name
  Acyl-CoA:diacylglycerol acyltransferase; Antigen 85 complex C; Short name:; 85C; Short name:; Ag85C; Fibronectin-binding protein C; Short name:; Fbps C
• Protein origin
  E.coli
• Protein region
  46-340aa
• Protein sequence
  AFSRPGLPVEYLQVPSASMGRDIKVQFQGGGPHAVYLLDGLRAQDDYNGWDINTPAFEEYYQSGLSVIMPVGGQSSFYTDWYQPSQSNGQNYTYKWETFLTREMPAWLQANKGVSPTGNAAVGLSMSGGSALILAAYYPQQFPYAASLSGFLNPSEGWWPTLIGLAMNDSGGYNANSMWGPSSDPAWKRNDPMVQIPRLVANNTRIWVYCGNGTPSDLGGDNIPAKFLEGLTLRTNQTFRDTYAADGGRNGVFNFPPNGTHSWPYWNEQLVAMKADIQHVLNGATPPAAPAAPAA
• Information about sequence
  Full Length
• Expected molecular weight
  48.07kDa
• Protein purity
  ≥ 90%
• Storage recommendation
  Aliquot and store at -20°C. Minimize freezing and thawing.
• Use before
  1 year
• Shipping requirements
  Blue ice
• Estimated production time
  7-11 business days
• Notes
  For research use only. Not for diagnostic procedures.
• Hyperlink
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  Mycobacterium   tuberculosis   Diacylglycerol   acyltransferase/mycolyltransferase   Ag85C   fbpC  
• Short name
  Recombinant Mycobacterium tuberculosis Diacylglycerol acyltransferase/mycolyltransferase Ag85C(fbpC)
• Technique
  Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Label
  N-terminal 6xHis-tagged
• Alternative name
  Rec. Mycobacterium tuberculosis Diacylglycerol acyltransferase/mycolyltransferase Ag85C(fbpC)
• Alternative technique
  rec
• Disease
  mycobacterium

MeSH Data

• Name
  Tuberculin Test
• Concept
  Scope note: One of several skin tests to determine past or present tuberculosis infection. A purified protein derivative of the tubercle bacilli, called tuberculin, is introduced into the skin by scratch, puncture, or interdermal injection.
• Tree numbers
  • E01.370.225.812.871.800
  • E05.200.812.871.800
  • E05.478.594.890.800
• Qualifiers
  ethics, mortality, psychology, trends, veterinary, history, classification, economics, instrumentation, methods, nursing, standards, adverse effects, statistics & numerical data

Similar products