• Catalog number
    RPC20078
  • Product name
    Recombinant Mouse Protein S100-A8(S100a8)
  • Size
    500 μg
  • Verified reactivity
    Mus musculus (Mouse)
  • Protein number
    P27005
  • Gene number
    S100a8
  • Other name
    Calgranulin-AChemotactic cytokine CP-10Leukocyte L1 complex light chain; Migration inhibitory factor-related protein 8 ; MRP-8 ; p8Pro-inflammatory S100 cytokine; S100 calcium-binding protein A8
  • Protein origin
    E.coli
  • Protein region
    2-89aa
  • Protein sequence
    PSELEKALSNLIDVYHNYSNIQGNHHALYKNDFKKMVTTECPQFVQNINIENLFRELDINSDNAINFEEFLAMVIKVGVASHKDSHKE
  • Information about sequence
    Full Length
  • Label
    N-terminal GST-tagged
  • Expected molecular weight
    37.6kDa
  • Protein purity
    ≥ 90%
  • Storage recommendation
    Aliquot and store at -20°C. Minimize freezing and thawing.
  • Use before
    1 year
  • Shipping requirements
    Blue ice
  • Estimated production time
    7-11 business days
  • Notes
    For research use only. Not for diagnostic procedures.
  • Hyperlink
  • Alternative to gene target
    • [ "S100 calcium binding protein A8", "60B8AG and CAGA and CFAG and CGLA and CP-10 and L1Ag and MA387 and MIF and MRP8 and NIF and P8", "S100A8 and IDBG-102654 and ENSG00000143546 and 6279", "RAGE receptor binding", "nuclei", "S100a8 and IDBG-168077 and ENSMUSG00000056054 and 20201", "S100A8 and IDBG-632868 and ENSBTAG00000012640 and 616818" ]
  • Gene target
    Protein S100-A8 S100a8
  • Gene info
    Gene info
    Gene info
    Gene info
    Gene info
    Gene info
    Gene info
  • Gene symbol
    S100A8, SNAR-A8, PCDHGA8, S100A1, S100Z, ZNF3, S100A9
  • Host
    mouse
  • Short name
    Recombinant Mouse Protein S100-A8(S100a8)
  • label filter
    • N terminal GST tagged
  • technique filter
    • Recombinant
    • Mouse
  • Technique
    Recombinant, Mouse, mouses, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Alternative technique
    rec, murine