Recombinant Mouse Glutaminyl-peptide cyclotransferase(Qpct)

• Catalog number
  RPC20598
• Price
  Please ask
• Size
  20 μg

• Verified reactivity
  Mus musculus (Mouse)
• Protein number
  Q9CYK2
• Gene number
  Qpct
• Other name
  Glutaminyl cyclase; Short name:QC
• Protein origin
  Mammalian cell
• Protein region
  36-362aa
• Protein sequence
  AWTQEKNHHQPAHLNSSSLQQVAEGTSISEMWQNDLRPLLIERYPGSPGSYSARQHIMQRIQRLQAEWVVEVDTFLSRTPYGYRSFSNIISTLNPEAKRHLVLACHYDSKYFPRWDSRVFVGATDSAVPCAMMLELARALDKKLHSLKDVSGSKPDLSLRLIFFDGEEAFHHWSPQDSLYGSRHLAQKMASSPHPPGSRGTNQLDGMDLLVLLDLIGAANPTFPNFFPKTTRWFNRLQAIEKELYELGLLKDHSLERKYFQNFGYGNIIQDDHIPFLRKGVPVLHLIASPFPEVWHTMDDNEENLHASTIDNLNKIIQVFVLEYLHL
• Information about sequence
  Full Length
• Expected molecular weight
  39.96kDa
• Protein purity
  ≥ 90%
• Storage recommendation
  Aliquot and store at -20°C. Minimize freezing and thawing.
• Use before
  1 year
• Shipping requirements
  Blue ice
• Estimated production time
  7-11 business days
• Notes
  For research use only. Not for diagnostic procedures.
• Hyperlink
• Test
  Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
• Latin name
  Mus musculus
• Description
  Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  Glutaminyl-peptide   cyclotransferase   Qpct  
• Gene symbol
  QPCT
• Short name
  Recombinant Mouse Glutaminyl-peptide cyclotransferase(Qpct)
• Technique
  Recombinant, peptide, Mouse, mouses, peptides, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Host
  mouse
• Label
  N-terminal 6xHis-tagged
• Species
  Mouse, Mouses
• Alternative name
  Rec. Mouse Glutaminyl-short protein sequence cyclotransferase(Qpct)
• Alternative technique
  rec, peptides, murine

Gene info

• Identity
  HGNC:9753
• Gene
  QPCT
• Long gene name
  glutaminyl-peptide cyclotransferase
• Synonyms
  • QC
  • GCT
• Synonyms name
  • glutaminyl cyclase
• GenBank acession
  • X71125
• Locus
  2p22.2
• Discovery year
  1999-11-16
• Entrez gene record
  25797
• Pubmed identfication
  • 7999256
• Classification
  • M28 metallopeptidases
• VEGA ID
  OTTHUMG00000100963

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products