• Catalog number
    RPC20413
  • Product name
    Recombinant Mouse Fibroblast growth factor 15(Fgf15)
  • Size
    10 μg
  • Verified reactivity
    Mus musculus (Mouse)
  • Protein number
    O35622
  • Gene name
    Fgf15
  • Other name
    Short name:FGF-15
  • Protein origin
    E.coli
  • Protein region
    26-218aa
  • Protein sequence
    RPLAQQSQSVSDEDPLFLYGWGKITRLQYLYSAGPYVSNCFLRIRSDGSVDCEEDQNERNLLEFRAVALKTIAIKDVSSVRYLCMSADGKIYGLIRYSEEDCTFREEMDCLGYNQYRSMKHHLHIIFIQAKPREQLQDQKPSNFIPVFHRSFFETGDQLRSKMFSLPLESDSMDPFRMVEDVDHLVKSPSFQK
  • Information about sequence
    Full Length of Mature Protein
  • Label
    N-terminal 6xHis-SUMO-tagged
  • Expected molecular weight
    37,23kDa
  • Protein purity
    ≥ 90%
  • Verified applications
    See product datasheet or contact us
  • Storage recommendation
    Aliquot and store at -20°C. Minimize freezing and thawing.
  • Use before
    1 year
  • Shipping requirements
    Blue ice
  • Estimated production time
    7-11 business days
  • Notes
    For research use only. Not for diagnostic procedures.
  • Hyperlink
  • Gene target
    Fibroblast growth factor 15 Fgf15
  • Host
    mouse
  • Short name
    Recombinant Mouse Fibroblast growth factor 15(Fgf15)
  • label filter
    • N terminal 6xHis SUMO tagged
  • technique filter
    • Recombinant
    • Mouse
  • Technique
    Recombinant, Mouse, mouses, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Alternative technique
    rec, murine