• Catalog number
    RPC20300
  • Product name
    Recombinant Leiurus quinquestriatus hebraeus Alpha-insect toxin LqhaIT
  • Size
    50 μg
  • Verified reactivity
    Leiurus quinquestriatus hebraeus (Yellow scorpion)
  • Protein number
    P17728
  • Gene number
    Please refer to GenBank
  • Other name
    Lqh-alpha-IT; Short name:; Alpha-IT
  • Protein origin
    E.coli
  • Protein region
    20-85aa
  • Protein sequence
    VRDAYIAKNYNCVYECFRDAYCNELCTKNGASSGYCQWAGKYGNACWCYALPDNVPIRVPGKCHRK
  • Information about sequence
    Full Length
  • Label
    N-terminal 6xHis-SUMO-tagged
  • Expected molecular weight
    23.52kDa
  • Protein purity
    ≥ 90%
  • Storage recommendation
    Aliquot and store at -20°C. Minimize freezing and thawing.
  • Use before
    1 year
  • Shipping requirements
    Blue ice
  • Estimated production time
    7-11 business days
  • Notes
    For research use only. Not for diagnostic procedures.
  • Hyperlink
  • Gene target
    Leiurus quinquestriatus hebraeus Alpha LqhaIT
  • Short name
    Recombinant Leiurus quinquestriatus hebraeus Alpha- LqhaIT
  • label filter
    • N terminal 6xHis SUMO tagged
  • technique filter
    • Recombinant
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Alternative technique
    rec