gentaur logogentaur logo
x

Recombinant Human Tumor necrosis factor receptor superfamily member 25(TNFRSF25),partial

  • Catalog number
    RPC20412
  • Product name
    Recombinant Human Tumor necrosis factor receptor superfamily member 25(TNFRSF25),partial
  • Size
    500 μg
  • Verified reactivity
    Homo sapiens (Human)
  • Protein number
    Q93038
  • Gene number
    TNFRSF25
  • Other name
    Apo-3; Apoptosis-inducing receptor AIR; Apoptosis-mediating receptor DR3; Apoptosis-mediating receptor TRAMP; Death receptor 3; Lymphocyte-associated receptor of death; Short name:LARD
  • Protein origin
    E.coli
  • Protein region
    25-199aa
  • Protein sequence
    QGGTRSPRCDCAGDFHKKIGLFCCRGCPAGHYLKAPCTEPCGNSTCLVCPQDTFLAWENHHNSECARCQACDEQASQVALENCSAVADTRCGCKPGWFVECQVSQCVSSSPFYCQPCLDCGALHRHTRLLCSRRDTDCGTCLPGFYEHGDGCVSCPTSTLGSCPERCAAVCGWRQ
  • Information about sequence
    Extracellular Domain
  • Label
    N-terminal 6xHis-tagged
  • Expected molecular weight
    23.38kDa
  • Protein purity
    ≥ 90%
  • Storage recommendation
    Aliquot and store at -20°C. Minimize freezing and thawing.
  • Use before
    1 year
  • Shipping requirements
    Blue ice
  • Estimated production time
    7-11 business days
  • Notes
    For research use only. Not for diagnostic procedures.
  • Hyperlink
    Hyperlink
  • Alternative to gene target
    • [ "tumor necrosis factor receptor superfamily, member 25", "APO-3 and DDR3 and DR3 and LARD and TNFRSF12 and TR3 and TRAMP and WSL-1 and WSL-LR", "TNFRSF25 and IDBG-227097 and ENSG00000215788 and 8718", "protein binding", "Extracellular", "Tnfrsf25 and IDBG-206339 and ENSMUSG00000024793 and 85030", "BT.30010 and IDBG-633838 and ENSBTAG00000006519 and 783432" ]
  • Gene target
    Tumor necrosis factor receptor superfamily member 25 TNFRSF25 partial
    • Gene info
  • Gene symbol
    TNFRSF25
  • Short name
    Recombinant Tumor necrosis factor receptor superfamily member 25(TNFRSF25),partial
  • label filter
    • N terminal 6xHis tagged
  • technique filter
    • Recombinant
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Alternative technique
    rec
  • Tissue
    tumor
  • tissue filter
    • tumor