gentaur logogentaur logo
x

Recombinant Human IgG receptor FcRn large subunit p51(FCGRT),partial

  • Catalog number
    RPC20229
  • Product name
    Recombinant Human IgG receptor FcRn large subunit p51(FCGRT),partial
  • Size
    100 μg
  • Verified reactivity
    Homo sapiens (Human)
  • Protein number
    P55899
  • Gene number
    FCGRT
  • Other name
    IgG Fc fragment receptor transporter alpha chainNeonatal Fc receptor
  • Protein origin
    Yeast
  • Protein region
    24-297aa
  • Protein sequence
    AESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKSS
  • Information about sequence
    Extracellular Domain
  • Label
    N-terminal 6xHis-tagged
  • Expected molecular weight
    32.4kDa
  • Protein purity
    ≥ 90%
  • Storage recommendation
    Aliquot and store at -20°C. Minimize freezing and thawing.
  • Use before
    1 year
  • Shipping requirements
    Blue ice
  • Estimated production time
    7-11 business days
  • Notes
    For research use only. Not for diagnostic procedures.
  • Hyperlink
    Hyperlink
  • Alternative to gene target
    • [ "Fc fragment of IgG, receptor, transporter, alpha", "alpha-chain and FCRN", "FCGRT and IDBG-63001 and ENSG00000104870 and 2217", "beta-2-microglobulin binding", "Plasma membranes", "Fcgrt and IDBG-181534 and ENSMUSG00000003420 and 14132", "FCGRT and IDBG-640575 and ENSBTAG00000013926 and 338062" ]
  • Gene target
    receptor FcRn subunit p51 FCGRT partial
    • Gene info
  • Gene symbol
    FCGRT
  • Isotype
    IgG, IgG
  • isotype filter
    • IgG
  • Short name
    Recombinant IgG receptor FcRn subunit p51(FCGRT),partial
  • label filter
    • N terminal 6xHis tagged
  • technique filter
    • Recombinant
    • IgG
  • Technique
    Recombinant, IgG, IgGs, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Alternative technique
    rec, immunoglobulins