• Catalog number
    RPC20488
  • Product name
    Recombinant Human Homeobox protein Nkx-3.2(Nkx3-2)
  • Size
    100 μg
  • Verified reactivity
    Homo sapiens (Human)
  • Protein number
    P97503
  • Gene number
    Nkx3-2
  • Other name
    Bagpipe homeobox protein homolog 1; Homeobox protein NK-3 homolog B
  • Protein origin
    E.coli
  • Protein region
    1-333aa
  • Protein sequence
    MAVRGSGTLTPFSIQAILNKKEERGGLATPEGRPAPGGTEVAVTAAPAVCCWRIFGETEAGALGGAEDSLLASPARTRTAVGQSAESPGGWDSDSALSEENEGRRRCADVPGASGTGRARVTLGLDQPGCELHAAKDLEEEAPVRSDSEMSASVSGDHSPRGEDDSVSPGGARVPGLRGAAGSGASGGQAGGVEEEEEPAAPKPRKKRSRAAFSHAQVFELERRFNHQRYLSGPERADLAASLKLTETQVKIWFQNRRYKTKRRQMAADLLASAPAAKKVAVKVLVRDDQRQYLPGEVLRPPSLLPLQPSYYYPYYCLPGWALSTCAAAAGTQ
  • Information about sequence
    Full Length
  • Label
    NO-tagged
  • Expected molecular weight
    36.96kDa
  • Protein purity
    ≥ 90%
  • Storage recommendation
    Aliquot and store at -20°C. Minimize freezing and thawing.
  • Use before
    1 year
  • Shipping requirements
    Blue ice
  • Estimated production time
    7-11 business days
  • Notes
    For research use only. Not for diagnostic procedures.
  • Hyperlink
  • Alternative to gene target
    • [ "NK3 homeobox 2", "BAPX1 and NKX3.2 and NKX3B and SMMD", "NKX3-2 and IDBG-10163 and ENSG00000109705 and 579", "sequence-specific DNA binding", "nuclei", "Nkx3-2 and IDBG-160594 and ENSMUSG00000049691 and 12020", "BT.106450 and IDBG-643956 and ENSBTAG00000010896 and 616907" ]
  • Gene target
    Homeobox protein Nkx-3 2 Nkx3-2
  • Short name
    Recombinant Homeobox protein Nkx-3 2(Nkx3-2)
  • label filter
    • NO tagged
  • technique filter
    • Recombinant
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Alternative technique
    rec