gentaur logogentaur logo
x

Recombinant Human High mobility group protein B1(Hmgb1)

  • Catalog number
    RPC20328
  • Product name
    Recombinant Human High mobility group protein B1(Hmgb1)
  • Size
    10 μg
  • Verified reactivity
    Homo sapiens (Human)
  • Protein number
    P09429 
  • Gene name
    Hmgb1
  • Other name
    High mobility group protein 1; Short name:; HMG-1
  • Protein origin
    Yeast
  • Protein region
    2-215aa
  • Protein sequence
    GKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE
  • Information about sequence
    Full Length
  • Label
    N-terminal 6xHis-tagged
  • Expected molecular weight
    26,76kDa
  • Protein purity
    ≥ 90%
  • Verified applications
    See product datasheet or contact us
  • Storage recommendation
    Aliquot and store at -20°C. Minimize freezing and thawing.
  • Use before
    1 year
  • Shipping requirements
    Blue ice
  • Estimated production time
    7-11 business days
  • Notes
    For research use only. Not for diagnostic procedures.
  • Hyperlink
    Hyperlink
  • Alternative to gene target
    • [ "high mobility group box 1", "HMG1 and HMG3 and SBP-1", "HMGB1 and IDBG-21100 and ENSG00000189403 and 3146", "DNA binding", "nuclei", "Hmgb1 and IDBG-209311 and ENSMUSG00000066551 and 100862258,102642363,15289,619937", "HMGB1 and IDBG-630533 and ENSBTAG00000018103 and 282691" ]
  • Gene target
    mobility group protein B1 Hmgb1
  • Short name
    Recombinant mobility group protein B1(Hmgb1)
  • label filter
    • N terminal 6xHis tagged
  • technique filter
    • Recombinant
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Alternative technique
    rec