Recombinant Human CD81 antigen(CD81),partial

  • Catalog number
    RPC20021
  • Price
    Please ask
  • Size
    1 mg
  • Verified reactivity
    Homo sapiens (Human)
  • Protein number
    P60033
  • Gene number
    CD81
  • Other name
    26 kDa cell surface protein TAPA-1Target of the antiproliferative antibody 1Tetraspanin-28 ; Tspan-28; CD81
  • Protein origin
    E.coli
  • Protein region
    113-201aa
  • Protein sequence
    FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGK
  • Information about sequence
    Extracellular Domain
  • Expected molecular weight
    25.8kDa
  • Protein purity
    ≥ 90%
  • Storage recommendation
    Aliquot and store at -20°C. Minimize freezing and thawing.
  • Use before
    1 year
  • Shipping requirements
    Blue ice
  • Estimated production time
    7-11 business days
  • Notes
    For research use only. Not for diagnostic procedures.
  • Description
    Antigens are peptides or recombinant or native dependent on the production method.
  • Properties
    Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
    CD81   CD81   partial  
  • Gene symbol
    CD81-AS1, CD81
  • Short name
    Recombinant CD81 antigen(CD81),partial
  • Technique
    Recombinant, antigen, antigenes, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Label
    N-terminal 6xHis-SUMO-tagged
  • Species
    Human, Humans
  • Alternative name
    Rec. H. sapiens CD81 molecule protein(CD81 molecule),partial
  • Alternative technique
    rec, antigenes
  • Alternative to gene target
    CD81 molecule, CVID6 and S5.7 and TAPA1 and TSPAN28, CD81 and IDBG-22455 and ENSG00000110651 and 975, MHC class II protein complex binding, Cell surfaces, Cd81 and IDBG-212677 and ENSMUSG00000037706 and 12520, CD81 and IDBG-645214 and ENSBTAG00000047495 and 511435
Gene info
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee