gentaur logogentaur logo
x

Recombinant Human CD81 antigen(CD81),partial

  • Catalog number
    RPC20021
  • Product name
    Recombinant Human CD81 antigen(CD81),partial
  • Size
    1 mg
  • Verified reactivity
    Homo sapiens (Human)
  • Protein number
    P60033
  • Gene number
    CD81
  • Other name
    26 kDa cell surface protein TAPA-1Target of the antiproliferative antibody 1Tetraspanin-28 ; Tspan-28; CD81
  • Protein origin
    E.coli
  • Protein region
    113-201aa
  • Protein sequence
    FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGK
  • Information about sequence
    Extracellular Domain
  • Label
    N-terminal 6xHis-SUMO-tagged
  • Expected molecular weight
    25.8kDa
  • Protein purity
    ≥ 90%
  • Storage recommendation
    Aliquot and store at -20°C. Minimize freezing and thawing.
  • Use before
    1 year
  • Shipping requirements
    Blue ice
  • Estimated production time
    7-11 business days
  • Notes
    For research use only. Not for diagnostic procedures.
  • Hyperlink
    Hyperlink
  • Alternative to gene target
    • [ "CD81 molecule", "CVID6 and S5.7 and TAPA1 and TSPAN28", "CD81 and IDBG-22455 and ENSG00000110651 and 975", "MHC class II protein complex binding", "Cell surfaces", "Cd81 and IDBG-212677 and ENSMUSG00000037706 and 12520", "CD81 and IDBG-645214 and ENSBTAG00000047495 and 511435" ]
  • Gene target
    CD81 CD81 partial
    • Gene info
    Gene info
    Locus Specific Databases:LRG_142
  • Gene symbol
    CD81-AS1, CD81
  • Short name
    Recombinant CD81 antigen(CD81),partial
  • label filter
    • N terminal 6xHis SUMO tagged
  • technique filter
    • Recombinant
    • antigen
  • Technique
    Recombinant, antigen, antigenes, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Alternative technique
    rec, antigenes