• Catalog number
    RPC20387
  • Product name
    Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 7(CEACAM7)
  • Size
    10 μg
  • Verified reactivity
    Homo sapiens (Human)
  • Protein number
    Q14002
  • Gene name
    CEACAM7
  • Other name
    Carcinoembryonic antigen CGM2
  • Protein origin
    E.coli
  • Protein region
    36-242aa
  • Protein sequence
    TNIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKGERVHANYRIIGYVKNISQENAPGPAHNGRETIYPNGTLLIQNVTHNDAGFYTLHVIKENLVNEEVTRQFYVFSEPPKPSITSNNFNPVENKDIVVLTCQPETQNTTYLWWVNNQSLLVSPRLLLSTDNRTLVLLSATKNDIGPYECEIQNPVGASRSDPVTLNVRYESVQAS
  • Information about sequence
    Full Length
  • Label
    N-terminal 6xHis-SUMO-tagged
  • Expected molecular weight
    39,34kDa
  • Protein purity
    ≥ 90%
  • Verified applications
    See product datasheet or contact us
  • Storage recommendation
    Aliquot and store at -20°C. Minimize freezing and thawing.
  • Use before
    1 year
  • Shipping requirements
    Blue ice
  • Estimated production time
    7-11 business days
  • Notes
    For research use only. Not for diagnostic procedures.
  • Hyperlink
  • Alternative to gene target
    • [ "carcinoembryonic antigen-related cell adhesion molecule 7", "CEA and CGM2", "CEACAM7 and IDBG-53139 and ENSG00000007306 and 1087", "protein binding", "Plasma membranes" ]
  • Gene target
    Carcinoembryonic related adhesion molecule 7 CEACAM7
  • Gene info
  • Gene symbol
    CEACAM7
  • Short name
    Recombinant Carcinoembryonic antigen- adhesion molecule 7(CEACAM7)
  • label filter
    • N terminal 6xHis SUMO tagged
  • technique filter
    • Recombinant
    • antigen
  • Technique
    Recombinant, antigen, antigenes, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Alternative technique
    rec, antigenes
  • Tissue
    cell
  • tissue filter
    • cell