Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 3(CEACAM3),Partial

  • Catalog number
    RPC20522
  • Price
    Please ask
  • Size
    1 mg
  • Verified reactivity
    Homo sapiens (Human)
  • Protein number
    P40198 
  • Gene number
    CEACAM3
  • Other name
    Carcinoembryonic antigen CGM1; CD_antigen: CD66d
  • Protein origin
    E.coli
  • Protein region
    35-155aa
  • Protein sequence
    KLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNSLIVGYVIGTQQATPGAAYSGRETIYTNASLLIQNVTQNDIGFYTLQVIKSDLVNEEATGQFHVYQENAPGLPVGAVAG
  • Information about sequence
    Extracellular Domain
  • Expected molecular weight
    29.43kDa
  • Protein purity
    ≥ 90%
  • Storage recommendation
    Aliquot and store at -20°C. Minimize freezing and thawing.
  • Use before
    1 year
  • Shipping requirements
    Blue ice
  • Estimated production time
    7-11 business days
  • Notes
    For research use only. Not for diagnostic procedures.
  • Description
    cell adhesion molecules play a role in cell growth and activation and are often identified by WB or ELISA as in the Recombinant Carcinoembryonic antigen- adhesion molecule 3(CEACAM3),Partial. Antigens are peptides or recombinant or native dependent on the production method. For cells, cell lines and tissues in culture till half confluency. Whole adhesion and interacting molecules are  present in lysates used as reference for ELISA quantification of these molecules and their subunits.
  • Properties
    Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Gene symbol
    CEACAM3
  • Short name
    Recombinant Carcinoembryonic antigen- adhesion molecule 3(CEACAM3),Partial
  • Technique
    Recombinant, antigen, antigenes, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Label
    N-terminal 6xHis-SUMO-tagged
  • Species
    Human, Humans
  • Alternative name
    Rec. H. sapiens Carcinoembryonic protein-related cellular adhesion molecule 3(carcinoembryonic antigen-related cellular adhesion molecule 3),Partial
  • Alternative technique
    rec, antigenes
  • Alternative to gene target
    carcinoembryonic antigen-related cell adhesion molecule 3, CD66D and CEA and CGM1 and W264 and W282, CEACAM3 and IDBG-53253 and ENSG00000170956 and 1084, Plasma membranes
  • Tissue
    cell
Gene info
  • Identity
  • Gene
  • Long gene name
    CEA cell adhesion molecule 3
  • Synonyms gene
  • Synonyms gene name
    • carcinoembryonic antigen-related cell adhesion molecule 3
    • carcinoembryonic antigen related cell adhesion molecule 3
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    1991-09-12
  • Entrez gene record
  • RefSeq identity
  • Classification
    • CD molecules
    • V-set domain containing
    • CEA cell adhesion molecule family
  • VEGA ID
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee