gentaur logogentaur logo
x

Clostridium botulinum D Toxiod, Clone: KB22, Mouse Monoclonal antibody-; ELISA/IF

  • Catalog number
    C198-10
  • Product name
    Recombinant Human Fibroblast Growth Factor 9/FGF-9
  • Size
    10 ug
  • Description
    Recombinant Human Fibroblast Growth Factor 9 is produced by our E.coli expression system and the target gene encoding Met1-Ser208 is expressed.
  • Species reactivity
    Human
  • Origin
    Escherichia coli
  • Peptide sequence
    MAPLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS
  • Estimated molecular weight
    23,44 kDa
  • Protein purity
    Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin level
    Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Shipping condition
    Ambient/Room Temperature
  • Package form
    Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
  • Storage conditions
    Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
  • Reconstitution conditions
    See included datasheet or contact us for more information.
  • UniProt number
    P31371
  • Other related products
    Other_related_products
  • Gene target
    Fibroblast Growth Factor 9/FGF-9
    • Gene info
    Gene info
    Gene info
    Gene info
    • Identity:HGNC:37549
    • Gene:PIRC45
    • Long gene name:piwi-interacting RNA cluster 45
    • Discovery year:2009-11-05
    • Entrez gene record:100313813
    • Pubmed identification:17881367
    • Classification:Piwi-interacting RNA clusters
    Gene info
    • Identity:HGNC:37551
    • Gene:PIRC47
    • Long gene name:piwi-interacting RNA cluster 47
    • Discovery year:2009-11-05
    • Entrez gene record:100313859
    • Pubmed identification:17881367
    • Classification:Piwi-interacting RNA clusters
    Gene info
    • Identity:HGNC:37542
    • Gene:PIRC38
    • Long gene name:piwi-interacting RNA cluster 38
    • Discovery year:2009-11-05
    • Entrez gene record:100313788
    • Pubmed identification:17881367
    • Classification:Piwi-interacting RNA clusters
    Gene info
    • Identity:HGNC:37547
    • Gene:PIRC43
    • Long gene name:piwi-interacting RNA cluster 43
    • Discovery year:2009-11-05
    • Entrez gene record:100313857
    • Pubmed identification:17881367
    • Classification:Piwi-interacting RNA clusters
  • Gene symbol
    FGF9, RNU6-9, FGF18, PIRC45, PIRC47, PIRC38, PIRC43
  • Short name
    Recombinant Fibroblast Growth Factor 9/FGF-9
  • technique filter
    • Recombinant
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Alternative technique
    rec