-
Stock availability
In Stock
-
Scientific context
Superoxide dismutase (SOD) is an endogenously produced intracellular enzyme present in almost every cell in the body (3). It works by catalyzing the dismutation of the superoxide radical O2ˉ to O2 and H2O2, which are then metabolized to H2O and O2 by catalase and glutathione peroxidase (2, 5). In general, SODs play a major role in antioxidant defense mechanisms (4). There are two main types of SOD in mammalian cells. One form (SOD1) contains Cu and Zn ions as a homodimer and exists in the cytoplasm. The two subunits of 16 kDa each are linked by two cysteines forming an intra-subunit disulphide bridge (3). The second form (SOD2) is a manganese containing enzyme and resides in the mitochondrial matrix. It is a homotetramer of 80 kDa. The third form (SOD3 or EC-SOD) is like SOD1 in that it contains Cu and Zn ions, however it is distinct in that it is a homotetramer, with a mass of 30 kDA and it exists only in the extracellular space(8). SOD3 can also be distinguished by its heparin-binding capacity (1).
-
Protein target
Mn SOD
-
Protein reactivity
Human
-
Certificate of analysis
This product has been certified >90% pure using SDS-PAGE analysis.
-
Protein description
Human Recombinant Mn SOD Protein
-
Other name
Manganese SOD Protein, IPO B Protein, Mn SOD Protein, SOD2 Protein
-
Primary research area
Cancer, Oxidative Stress, Cell Signaling, Trafficking, Chaperones
-
Category
Protein
-
Brand name
none
-
Origin
Recombinant
-
NCBI number
BC070913
-
Gene number
24787
-
Protein number
P04179
-
Verified applications
WB, SDS-PAGE
-
Relevant bio activity
Mn SOD Protein
-
Protein expression model
E. coli
-
Protein charasterics
See included datasheet.
-
Peptide sequence
MLSRAVCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
-
Protein purification
Affinity Purified
-
Purity pourcentage
>90% High purity
-
Recommended buffer for storage
50mM Tris/HCl pH7.7, 0.15M NaCl, 5mM DTT, 10% glycerol
-
Protein concentration
Lot/batch specific. See included datasheet.
-
Protein specificity
~25 kDa
-
Protein tag
His tag
-
Storage recommendations
-20°C
-
Shipping recommendations
Blue Ice or 4°C
-
Supplementary useful information
Please see included datasheet or contact us
-
Protein cell localization
Mitochondrion Matrix
-
Bibliography
1. Adachi T., et al. (1992) Clin. Chim. Acta. 212: 89-102. 2. Barrister J.V., et al. (1987) Crit. Rev. Biochem. 22: 111-180. 3. Furukawa Y., and O’Halloran T. (2006) Antioxidants &Redo Signaling. 8 (No 5): 6. 4. Gao B., et al. (2003). Am J Physiol Lung Cell Mol Physiol. 284: L917-L925. 5. Hassan H.M. (1988). Free Radical Biol. Med. 5: 377-385. 6. Kurobe N., et al. (1990) Clinica Chimica Acta. 192: 171-180. 7. Ojika T., et al. (1991) Acta Histochem Cytochem. 24(50): 489-495. 8. Wispe J.R., et al. (1989) BBA. 994: 30-36.
-
Release date
8-Jun-2009
-
PubMed number
Not added. Please refer to PubMed
-
Tested applications
to be tested
-
Tested species reactivity
to be tested
-
-
Representative figure legend
SDS-PAGE of 25kDa human Mn SOD (SPR-131). SDS-Page of human SOD (Mn) Protein (SPR-131)
-
Warnings
Non-hazardous materials
-
Protein origin
Canada
-
Total weight kg
1.4
-
Net weight g
0.1
-
-
Properties
Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
-
Source
Recombinants or rec. proteins
-
Group
recombinants
