-
Stock availability
In Stock
-
Scientific context
HSP27s belong to an abundant and ubiquitous family of small heat shock proteins (sHSP). It is an important HSP found in both normal human cells and cancer cells. The basic structure of most sHSPs is a homologous and highly conserved amino acid sequence, with an α-crystallin-domain at the C-terminus and the WD/EPF domain at the less conserved N-terminus. This N-terminus is essential for the development of high molecular oligomers (1, 2). HSP27-oligomers consist of stable dimers formed by as many as 8-40 HSP27 protein monomers (3). The oligomerization status is connected with the chaperone activity: aggregates of large oligomers have high chaperone activity, whereas dimers have no chaperone activity (4). HSP27 is localized to the cytoplasm of unstressed cells but can redistribute to the nucleus in response to stress, where it may function to stabilize DNA and/or the nuclear membrane. Other functions include chaperone activity (as mentioned above), thermo tolerance in vivo, inhibition of apoptosis, and signal transduction. Specifically, in vitro, it acts as an ATP-independent chaperone by inhibiting protein aggregation and by stabilizing partially denatured proteins, which ensures refolding of the HSP70 complex. HSP27 is also involved in the apoptotic signaling pathway because it interferes with the activation of cytochrome c/Apaf-1/dATP complex, thereby inhibiting the activation of procaspase-9. It is also hypothesized that HSP27 may serve some role in cross-bridge formation between actin and myosin (5). And finally, HSP27 is also thought to be involved in the process of cell differentiation. The up-regulation of HSP27 correlates with the rate of phosphorylation and with an increase of large oligomers. It is possible that HSP27 may play a crucial role in termination of growth (6). Looking for more information on HSP27? Visit our new HSP27 Scientific Resource Guide at more.
-
Protein target
HSP27
-
Protein reactivity
Human
-
Certificate of analysis
This product has been certified >90% pure using SDS-PAGE analysis.
-
Protein description
Human Recombinant HSP27 Full Length Protein
-
Other name
28kDa heat shock Protein, CMT2F Protein, HSP25 Protein, HSP27 Protein, HSP28 Protein, HSPB1 Protein, SRP27 Protein
-
Primary research area
Cancer, Heat Shock
-
Category
Protein
-
Brand name
none
-
Origin
Recombinant
-
NCBI number
BC012768
-
Gene number
3315
-
Protein number
P04792
-
Verified applications
WB, SDS-PAGE, Functional Assay, ELISA
-
Relevant bio activity
HSP27 Protein
-
Protein expression model
E. coli
-
Protein charasterics
Full Length
-
Peptide sequence
MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK
-
Protein purification
Affinity Purified
-
Purity pourcentage
>90% High purity
-
Recommended buffer for storage
20mM Tris/HCl pH7.5, 0.45M NaCl, 10% glycerol, 5mM DTT
-
Protein concentration
Lot/batch specific. See included datasheet.
-
Protein specificity
~27 kDa
-
Protein tag
No tag
-
Storage recommendations
-20°C
-
Shipping recommendations
Blue Ice or 4°C
-
Supplementary useful information
Please see included datasheet or contact us
-
Protein cell localization
Cytoplasm, Nucleus
-
Bibliography
1. Kim K.K., Kim R., and Kim, S. (1998) Nature 394(6693): 595-599. 2. Van Montfort R., Slingsby C., and Vierling E. (2001) Addv Protein Chem. 59: 105-56. 3. Ehrnsperger M., Graber S., Gaestel M. and Buchner J. (1997) EMBO J. 16: 221-229. 4. Ciocca D.R., Oesterreich S., Chamness G.C., McGuire W.L., and Fugua S.A. (1993) J Natl Cancer Inst. 85 (19): 1558-70. 5. Sarto C. Binnz P.A. and Mocarelli P. (2000) Electrophoresis. 21(6): 1218-26. 6. Arrigo A.P. (2005) J Cell Biochem. 94(2): 241-6.
-
Release date
31-Aug-2009
-
PubMed number
Not added. Please refer to PubMed
-
Tested applications
to be tested
-
Tested species reactivity
to be tested
-
-
Representative figure legend
SDS-PAGE of 27kDa native human Hsp27 protein (SPR-118). SDS-Page of human HSP27 Protein (SPR-118)
-
Warnings
Non-hazardous materials
-
Protein origin
Canada
-
Total weight kg
1.4
-
Net weight g
0.1
-
-
Properties
Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
-
Source
Recombinants or rec. proteins
-
Group
recombinants