Filters
Technique
Supplier
Species
Label
Isotype
Host
Tissue
Virus
Disease
SKU Product name Supplier Catalog no. Size Price
01010240173 Human Secretory immunoglobulin A (SIgA) ELISA Kit Info ab-elisa elisas AE19543HU 48 wells plate Ask Ask
01010721231 Bovine Secretory immunoglobulin A (sIgA) ELISA Kit Info ab-elisa elisas AE19545BO 48 wells plate Ask Ask
01010993894 Guinea pig secretory Immunoglobulin A (sIgA) ELISA kit Info Kamiya KT-55060 96 well plate Ask Ask
01011242647 Secretory Component Glycoprotein, 80kD, free & bound to sIgA, Clone: SC-05, Mouse Monoclonal antibody-Hu; paraffin (trypsin) Info accurate-monoclonals MEDCLA129 1000ul Ask Ask
01011386843 Bovine Secretory immunoglobulin A (sIgA) ELISA Kit Info abebio AE19545BO-96 1x plate of 96 wells Ask Ask
01011388234 Human Secretory immunoglobulin A (SIgA) ELISA Kit Info abebio AE19543HU-96 1x plate of 96 wells Ask Ask
01011392270 ELISA test for Bovine Secretory immunoglobulin A (sIgA) Info abebio AE19545BO-48 1x plate of 48 wells Ask Ask
01011393661 ELISA test for Human Secretory immunoglobulin A (SIgA) Info abebio AE19543HU-48 1x plate of 48 wells Ask Ask
01011865324 secretory IgA (SIgA) ELISA Kit Info sincere E13651585 one plate of 96 wells per kit Ask Ask
01011865326 Secretory Immunoglobulin A(SIgA) ELISA Kit Info sincere E13651586 one plate of 96 wells per kit Ask Ask
01012044123 Goat anti Cat secretory IgA Info nordc GACa/sIgA 1 mL Ask Ask
01012045796 Rabbit anti Bovine secretory IgA Info nordc RAB/sIgA 1 mL Ask Ask
01012046145 Rabbit anti Swine secretory IgA Info nordc RASw/sIgA 1 mL Ask Ask
01012046206 Sheep anti Human secretory IgA Info nordc ShAHu/sIgA 1 mL Ask Ask
01012046283 Swine anti Goat secretory IgA Info nordc SwAG/sIgA 1 mL Ask Ask
01012051934 Guinea pig Helicobacter pylori sIgA ELISA kit Info BlueGen ELISAs E05H0269 96 well immunosorbent assay kit (48 available) Ask Ask
01012337912 Thapsigargin Info trca T339250 1 mg Ask Ask
01012363378 Secretory Immunoglobulin A (sIgA) ELISA kit Info cclone SEA641Ra 1 kit/96-well plate Ask Ask
01012363379 Secretory Immunoglobulin A (sIgA) ELISA kit Info cclone SEA641Mu 1 kit/96-well plate Ask Ask
01012363743 Secretory Immunoglobulin A (sIgA) ELISA kit Info cclone SEA641Hu 1 kit/96-well plate Ask Ask
01012365920 Secretory Immunoglobulin A (sIgA) ELISA kit Info cclone SEA641Bo 1 kit/96-well plate Ask Ask
01012368245 CLIA Kit for Secretory Immunoglobulin A (sIgA) ELISA kit Info cclone SCA641Bo 1 kit/96-well plate Ask Ask
01012369663 CLIA Kit for Secretory Immunoglobulin A (sIgA) ELISA kit Info cclone SCA641Hu 1 kit/96-well plate Ask Ask
01012369860 Secretory Immunoglobulin A (sIgA) ELISA kit Info cclone CEA641Ga 1 kit/96-well plate Ask Ask
01012370200 Secretory Immunoglobulin A (sIgA) ELISA kit Info cclone CEA641Po 1 kit/96-well plate Ask Ask
01012505712 Bovine Secretory Immunoglobulin A (sIgA) CLIA Kit, 96 well plate Info bioma EKU09842 96T Ask Ask
01012505713 Bovine Secretory Immunoglobulin A (sIgA) ELISA Kit, 96 well plate Info bioma EKU07233 96T Ask Ask
01012505714 Bovine secretory immunoglobulin A, sIgA ELISA Kit, 96 well plate Info bioma EKC31783 96T Ask Ask
01012506136 Chicken Secretory Immunoglobulin A (sIgA) ELISA Kit, 96 well plate Info bioma EKU07238 96T Ask Ask
01012506137 Chicken secretory immunoglobulin A, SIgA ELISA Kit, 96 well plate Info bioma EKC31987 96T Ask Ask
01012511875 Thapsigargin, Autophagy inhibitor Info stressma SIH-399-1MG 1 mg Ask Ask
01012511876 Thapsigargin, Autophagy inhibitor Info stressma SIH-399-5MG 5 mg Ask Ask
01012534812 IgA, Secretory (sIgA, Secretory IgA) Antibody Info MBS Polyclonals MBS623913 20ul Ask Ask
01012536237 IgA, Secretory Component, Free and Bound (sIgA, Secretory IgA) Antibody Info MBS Polyclonals MBS646695 10 miligrams Ask Ask
01012666695 Peptide Sequence (MLSKTVAPPQQARVSRKAIRAVPMMKNVNEGKGLFAPLVVVTRNIVGKKRFNQLRGKAIALHSQVITEFCKSIGADAKQRQGLIRLAKKNGERLGFLA) Info trca P285260 1 mg Ask Ask
01012678002 Human Secretory Immunoglobulin A (sIgA) CLIA Kit, 96 well plate Info bioma EKU08905 96T Ask Ask
01012678003 Human Secretory Immunoglobulin A (sIgA) ELISA Kit, 96 well plate Info bioma EKU07235 96T Ask Ask
01012678004 Human secretory immunoglobulin A, SIgA ELISA Kit, 96 well plate Info bioma EKC35480 96T Ask Ask
01012682387 Mouse Secretory Immunoglobulin A (sIgA) ELISA Kit, 96 well plate Info bioma EKU07236 96T Ask Ask
01012682388 Mouse secretory immunoglobulin A, sIgA ELISA Kit, 96 well plate Info bioma EKC37778 96T Ask Ask
01012683198 Pig secretory immunoglobulin A, SIgA ELISA Kit, 96 well plate Info bioma EKC38329 96T Ask Ask
01012683418 Porcine Secretory Immunoglobulin A (sIgA) ELISA Kit, 96 well plate Info bioma EKU08429 96T Ask Ask
01012683473 Rabbit secretory immunoglobulin A, sIgA ELISA Kit, 96 well plate Info bioma EKC38381 96T Ask Ask
01012685939 Rat Secretory Immunoglobulin A (sIgA) ELISA Kit, 96 well plate Info bioma EKU07237 96T Ask Ask
01012685940 Rat secretory immunoglobulin A, sIgA ELISA Kit, 96 well plate Info bioma EKC39677 96T Ask Ask
01013799837 ELISA kit for Human secretory immunoglobulin A,SIgA Info Pariselements PR-S11466 1 kit/96-wells plate Ask Ask
01013800479 ELISA kit for Mouse secretory immunoglobulin A,sIgA Info Pariselements PR-S20416 1 kit/96-wells plate Ask Ask
01013800914 ELISA kit for Rat secretory immunoglobulin A,sIgA Info Pariselements PR-S30312 1 kit/96-wells plate Ask Ask
01013801475 ELISA kit for Chicken secretory immunoglobulin A,SIgA Info Pariselements PR-S60021 1 kit/96-wells plate Ask Ask
01013803583 Secretory Immunoglobulin A,Siga ELISA Kit Info brter bioreagents BRTH1761 1 kit/96-wells plate Ask Ask
Ajax processing
sIgA - Search
Filters
Sitemap Contact
$
  • EUR
  • GBP
  • PLN
  • USD
X
Total products: 1 232 Current page: 1  Go to first | Next
Compact list
Compact list Extended list
Contact us
Ajax processing
Close
Chat with gentaur.com employee