Recombinant Halochromatium salexigens Photoactive yellow protein (pyp)

CAT:
399-CSB-EP304596HTP-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Halochromatium salexigens Photoactive yellow protein (pyp) - image 1

Recombinant Halochromatium salexigens Photoactive yellow protein (pyp)

  • Product Name Alternative:

    (PYP)
  • Abbreviation:

    Recombinant Halochromatium salexigens Photoactive yellow protein
  • Gene Name:

    Pyp
  • UniProt:

    P81046
  • Expression Region:

    1-125aa
  • Organism:

    Halochromatium salexigens (Chromatium salexigens)
  • Target Sequence:

    MNIVHFGSDDIENSLANMSDQDLNQLAFGAIQLDASGKVLQYNAAEEGITGRDPKSVIGKNFFEDVAPCTKSQEFQGRFKEGVANGNLATMFEYVFDYQMKPTKVKVHMKKALVDDSYWIFVKRL
  • Tag:

    N-terminal 6xHis-tagged
  • Type:

    In Stock Protein
  • Source:

    E.coli
  • Field of Research:

    Others
  • Relevance:

    Photoactive blue light protein. Probably functions as a photoreceptor for a negative phototaxis response.
  • Endotoxin:

    Not test
  • Purity:

    Greater than 90% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Molecular Weight:

    18.1 kDa
  • References & Citations:

    "Sequence evidence for strong conservation of the photoactive yellow proteins from the halophilic phototrophic bacteria Chromatium salexigens and Rhodospirillum salexigens." Koh M., van Driessche G., Samyn B., Hoff W.D., Meyer T.E., Cusanovich M.A., van Beeumen J.J. Biochemistry 35:2526-2534 (1996)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Full Length