EZH1 Rabbit pAb (APR30387N)

CAT:
882-APR30387N-01
Size:
50 µL
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
EZH1 Rabbit pAb (APR30387N) - image 1

EZH1 Rabbit pAb (APR30387N)

  • Background:

    EZH1 is a component of a noncanonical Polycomb repressive complex-2 (PRC2) that mediates methylation of histone H3 (see MIM 602812) lys27 (H3K27) and functions in the maintenance of embryonic stem cell pluripotency and plasticity (Shen et al., 2008 [PubMed 19026780]) .[supplied by OMIM, Mar 2009]
  • Synonyms:

    EZH1; KMT6B
  • Gene ID:

    2145
  • UniProt:

    Q92800
  • Cellular Locus:

    Nucleus
  • Applications:

    IP (Homo sapiens) WB (Rattus norvegicus)
  • Dilution:

    WB 1:500 - 1:2000 IF 1:50 - 1:200
  • Form:

    Liquid
  • Buffer:

    Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
  • Molecular Weight:

    Calculated MW: 68kDa/76kDa/80kDa/85kDa/86kDa Observed MW: 85kDa
  • Storage Conditions:

    Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
  • Overview:

    We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality EZH1 Rabbit pAb (APR30387N) .
  • Gene ID URL:

    https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2145
  • Uniprot URL:

    https://www.uniprot.org/uniprot/Q92800
  • AA Sequence:

    GEEEMIPGSVLISDAVFLELVDALNQYSDEEEEGHNDTSDGKQDDSKEDLPVTRKRKRHAIEGNKKSSKKQFPNDMIFSAIASMFPENGVPDDMKERYRELTEMSDPNALPPQCTPNIDGP