GLUT2/SLC2A2 Rabbit pAb (APR28709N)

• Background:

  This gene encodes an integral plasma membrane glycoprotein of the liver, islet beta cells, intestine, and kidney epithelium. The encoded protein mediates facilitated bidirectional glucose transport. Because of its low affinity for glucose, it has been suggested as a glucose sensor. Mutations in this gene are associated with susceptibility to diseases, including Fanconi-Bickel syndrome and noninsulin-dependent diabetes mellitus (NIDDM) . Alternative splicing results in multiple transcript variants of this gene.

• Synonyms:

  SLC2A2; GLUT2

• Gene ID:

  6514

• UniProt:

  P11168

• Cellular Locus:

  Membrane, Multi-pass membrane protein

• Applications:

  WB (Homo sapiens, Gallus gallus, Mus musculus, Mesocricetus auratus)

• Dilution:

  WB 1:500 - 1:2000 IHC 1:50 - 1:200

• Form:

  Liquid

• Buffer:

  Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Molecular Weight:

  Calculated MW: 44kDa/57kDa Observed MW: 57kDa

• Storage Conditions:

  Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

• Overview:

  We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality GLUT2/SLC2A2 Rabbit pAb (APR28709N) .

• Gene ID URL:

  https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6514

• Uniprot URL:

  https://www.uniprot.org/uniprot/P11168

• AA Sequence:

  MTEDKVTGTLVFTVITAVLGSFQFGYDIGVINAPQQVIISHYRHVLGVPLDDRKAINNYVINSTDELPTISYSMNPKPTPWAEEETVAAAQLITMLWSLS