GATAD2B Rabbit pAb (APR28650N)

CAT:
882-APR28650N-01
Size:
50 µL
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
GATAD2B Rabbit pAb (APR28650N) - image 1

GATAD2B Rabbit pAb (APR28650N)

  • Background:

    This gene encodes a zinc finger protein transcriptional repressor. The encoded protein is part of the methyl-CpG-binding protein-1 complex, which represses gene expression by deacetylating methylated nucleosomes. Mutations in this gene are linked to intellectual disability and dysmorphic features associated with mental retardation. [provided by RefSeq, Jun 2016]
  • Synonyms:

    GATAD2B; MRD18; P66beta; p68
  • Gene ID:

    57459
  • UniProt:

    Q8WXI9
  • Cellular Locus:

    Nucleus speckle
  • Dilution:

    WB 1:500 - 1:2000 IHC 1:50 - 1:200 IP 1:50 - 1:200
  • Form:

    Liquid
  • Buffer:

    Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
  • Molecular Weight:

    Calculated MW: 65kDa Observed MW: 80kDa
  • Storage Conditions:

    Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
  • Overview:

    We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality GATAD2B Rabbit pAb (APR28650N) .
  • Gene ID URL:

    https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=57459
  • Uniprot URL:

    https://www.uniprot.org/uniprot/Q8WXI9
  • AA Sequence:

    MDRMTEDALRLNLLKRSLDPADERDDVLAKRLKMEGHEAMERLKMLALLKRKDLANLEVPHELPTKQDGSGVKGYEEKLNGNLRPHGDNRTAGRPGKENINDEPVDMSARRSEPERGRLT