EPB41L2 Rabbit pAb (APR28508N)

• Background:

  Required for dynein-dynactin complex and NUMA1 recruitment at the mitotic cell cortex during anaphase.

• Synonyms:

  EPB41L2; 4.1-G; 4.1G

• Gene ID:

  2037

• UniProt:

  O43491

• Cellular Locus:

  Cell membrane, Cytoplasm, cytoskeleton

• Dilution:

  WB 1:200 - 1:2000 IF 1:50 - 1:200

• Form:

  Liquid

• Buffer:

  Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Molecular Weight:

  Calculated MW: 76kDa/83kDa/95kDa/112kDa Observed MW: 180kDa

• Storage Conditions:

  Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

• Overview:

  We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality EPB41L2 Rabbit pAb (APR28508N) .

• Gene ID URL:

  https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2037

• Uniprot URL:

  https://www.uniprot.org/uniprot/O43491

• AA Sequence:

  MTTEVGSVSEVKKDSSQLGTDATKEKPKEVAENQQNQSSDPEEEKGSQPPPAAESQSSLRRQKREKETSESRGISRFIPPWLKKQKSYTLVVAKDGGDKKEPTQAVVEEQVLDKEEPLPEEQRQAKGDAEEMAQKKQEIKVEVKEEKPSVSKEEKPSVSKVEMQPTELVSKEREEKVKETQEDKLEGGAAKRETKEVQTNELKAEKASQK