PTPMT1 Rabbit pAb (APR28371N)

• Background:

  Lipid phosphatase which dephosphorylates phosphatidylglycerophosphate (PGP to phosphatidylglycerol (PG (By similarity. PGP is an essential intermediate in the biosynthetic pathway of cardiolipin, a mitochondrial-specific phospholipid regulating the membrane integrity and activities of the organelle (By similarity. Has also been shown to display phosphatase activity toward phosphoprotein substrates, specifically mediates dephosphorylation of mitochondrial proteins, thereby playing an essential role in ATP production (By similarity. Has probably a preference for proteins phosphorylated on Ser and/or Thr residues compared to proteins phosphorylated on Tyr residues (By similarity. Probably involved in regulation of insulin secretion in pancreatic beta cells (By similarity. May prevent intrinsic apoptosis, probably by regulating mitochondrial membrane integrity.

• Synonyms:

  PTPMT1; DUSP23; MOSP; PLIP; PNAS-129

• Gene ID:

  114971

• UniProt:

  Q8WUK0

• Cellular Locus:

  Mitochondrion inner membrane

• Dilution:

  WB 1:500 - 1:2000

• Form:

  Liquid

• Buffer:

  Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Molecular Weight:

  Calculated MW: 15kDa/16kDa/22kDa Observed MW: 23kDa

• Storage Conditions:

  Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

• Overview:

  We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PTPMT1 Rabbit pAb (APR28371N) .

• Gene ID URL:

  https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=114971

• Uniprot URL:

  https://www.uniprot.org/uniprot/Q8WUK0

• AA Sequence:

  MAATALLEAGLARVLFYPTLLYTLFRGKVPGRAHRDWYHRIDPTVLLGALPLRSLTRQLVQDENVRGVITMNEEYETRFLCNSSQEWKRLGVEQLRLSTVDMTGIPTLDNLQKGVQFALKYQSLGQCVYVHCKAGRSRSATMVAAYLIQVHKWSPEEAVRAIAKIRSYIHIRPGQLDVLKEFHKQITARATKDGTFVISKT