ROS1 Rabbit pAb (APR23265N)

CAT:
882-APR23265N-01
Size:
50 µL
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
ROS1 Rabbit pAb (APR23265N) - image 1

ROS1 Rabbit pAb (APR23265N)

  • Background:

    This proto-oncogene, highly-expressed in a variety of tumor cell lines, belongs to the sevenless subfamily of tyrosine kinase insulin receptor genes. The protein encoded by this gene is a type I integral membrane protein with tyrosine kinase activity. The protein may function as a growth or differentiation factor receptor.
  • Synonyms:

    ROS1; MCF3; ROS; c-ros-1
  • Gene ID:

    6098
  • UniProt:

    P08922
  • Applications:

    WB (Mus musculus)
  • Dilution:

    WB 1:500 - 1:2000
  • Form:

    Liquid
  • Buffer:

    Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
  • Molecular Weight:

    Calculated MW: 263kDa Observed MW: 263kDa
  • Storage Conditions:

    Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
  • Overview:

    We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ROS1 Rabbit pAb (APR23255N9) .
  • Gene ID URL:

    https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6098
  • Uniprot URL:

    https://www.uniprot.org/uniprot/P08922
  • AA Sequence:

    IGDFGLARDIYKNDYYRKRGEGLLPVRWMAPESLMDGIFTTQSDVWSFGILIWEILTLGHQPYPAHSNLDVLNYVQTGGRLEPPRNCPDDLWNLMTQCWAQ